Details for Lyrate rockcress Locus 16048911

Position : sca3 ( 5`- 1274213 .. 1275120 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048911

Protein [Map View]
MSSSLEQEIFLQWGNKKRLRCLRAKDKKISRSKNSSRFLGQDTFLLQSTRFSRGSEGAILRSGLPDRRLEKEERYYTTRG
VVDNIGKVCLDENNNNGEDGNNKEESMWPKLFITLSNKEKEEDFMAMKGCKPSHRPKKRAKLIQRSLLLVSPGTWLADLC
PDRYDVRVKKSSKKRRARGLKAMGNMETDSD*

DNA
ATGTCGTCATCGTTAGAACAAGAAATCTTCTTACAGTGGGGAAACAAGAAGAGATTGAGATGTCTTAGAGCCAAAGACAA
AAAGATCTCTCGCAGTAAAAACTCTTCCCGCTTTCTAGGTCAAGATACCTTCCTCCTTCAATCCACTAGATTCTCCAGAG
GATCAGAAGGAGCAATCCTCAGATCTGGACTACCAGATCGCCGGCTGGAGAAAGAAGAGAGGTATTATACGACGAGAGGT
GTAGTTGATAACATTGGGAAAGTTTGTTTAGATGAAAACAATAATAATGGAGAAGATGGCAACAACAAGGAAGAGAGTAT
GTGGCCTAAGCTGTTTATAACATTATCAAACAAAGAGAAAGAAGAAGATTTCATGGCTATGAAAGGTTGCAAACCTTCTC
ATAGGCCTAAGAAGAGAGCCAAACTCATCCAAAGAAGCTTACTTTTGGTGAGTCCTGGAACATGGTTGGCTGACTTGTGC
CCAGATAGATATGATGTTAGGGTGAAGAAGAGCTCTAAGAAGAGGCGAGCAAGAGGGCTAAAAGCTATGGGAAATATGGA
GACTGATTCAGATTGA