Details for Lyrate rockcress Locus 16048904

Position : sca3 ( 5`- 6458426 .. 6455589 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048904

Protein [Map View]
MSMIASSSNSDPDSRSLQVLLDAFGSRFSLDDIAAAYCQASQNVDVAGEILFAMTEKTPQCDHVEMKNETSKPSQVYVPK
EVRRQEDSKAKVWRPKRNSISVGTVSSVIGKEYARTRPISNAPREATKPMKIDSRDIPETEIWSEEMPKSNEPKTNRAPT
DVEEFIVKMLGEGFQASQDVIHQVLGVCGYDVKKSTEKLLDLSDTKKYADVGISNEVVSFCYDFKFGSEEGRNAKNGLEK
EVLEALFSGTERYVGEPKVTRHFGERRPRVAGRPVFKPLEDPFQERVVAVKKSSNTSKEDEDENEFKAHRKAVREHLNQM
KEYYGAAAEAFSKGETERAHRLVEKGHFFGQKAREADDKSIAKMIDVKKDDDSTYEEDEVVTVNVNEHETKEALRLLKRQ
LNYFSGISSFKYLRVALGDKKEDFKSKRKHIVKLLEGESIAWTEEDSGLVMMIRVDKIDPKKLSFAKK*

DNA
ATGTCTATGATTGCAAGCTCTTCGAATAGTGATCCTGATTCAAGAAGCTTACAAGTGCTTCTCGATGCCTTTGGTTCTCG
TTTTTCGCTTGATGACATTGCTGCTGCTTATTGCCAAGCAAGTCAGAATGTCGATGTAGCTGGTGAGATTCTCTTTGCAA
TGACTGAAAAGACGCCTCAATGTGACCACGTTGAAATGAAGAACGAAACCTCAAAACCAAGTCAGGTCTATGTTCCCAAG
GAAGTTCGACGACAAGAGGATAGCAAAGCCAAAGTATGGAGGCCGAAGAGAAATTCTATATCAGTTGGTACTGTTTCAAG
TGTTATCGGTAAGGAGTATGCTAGAACCAGGCCTATATCAAATGCTCCCAGAGAAGCAACTAAGCCAATGAAGATAGACT
CAAGGGATATTCCAGAAACTGAGATATGGAGTGAAGAAATGCCAAAGAGTAACGAGCCAAAGACAAACAGGGCTCCAACT
GATGTGGAGGAATTTATCGTTAAGATGCTTGGAGAAGGCTTTCAAGCTAGCCAAGATGTCATTCACCAGGTTCTTGGCGT
ATGCGGATATGATGTGAAGAAGAGTACGGAGAAACTGCTTGACTTGTCTGATACCAAGAAATATGCTGATGTTGGAATTT
CCAATGAAGTTGTGAGCTTTTGTTATGACTTTAAGTTTGGTTCAGAGGAAGGGCGTAATGCTAAGAATGGTCTTGAAAAG
GAAGTTTTAGAAGCTTTGTTCTCAGGTACGGAAAGATATGTGGGAGAACCAAAAGTAACTCGACATTTTGGAGAAAGGAG
ACCAAGAGTTGCTGGTCGTCCTGTTTTTAAACCTCTGGAGGACCCTTTTCAAGAGAGAGTAGTTGCTGTAAAAAAATCGT
CCAATACATCTAAAGAAGATGAAGATGAAAATGAGTTTAAGGCACATCGTAAAGCAGTACGTGAGCATTTGAATCAGATG
AAAGAATATTATGGAGCTGCTGCAGAAGCATTCTCCAAAGGAGAAACCGAGCGAGCACACAGACTCGTGGAGAAGGGACA
CTTTTTTGGACAAAAAGCCCGAGAAGCGGATGACAAATCTATAGCAAAGATGATTGATGTCAAGAAAGACGATGATTCGA
CTTACGAGGAGGACGAGGTAGTGACAGTGAATGTGAATGAACACGAAACAAAGGAAGCACTTCGTCTTCTCAAGCGCCAA
CTAAATTACTTCTCTGGCATTTCATCTTTTAAGTACCTCAGAGTCGCATTGGGTGACAAAAAGGAAGATTTCAAGAGCAA
ACGAAAGCATATCGTTAAGCTGCTGGAGGGAGAATCCATTGCTTGGACTGAAGAAGATAGCGGCCTCGTGATGATGATTC
GTGTTGATAAGATTGACCCCAAGAAATTGAGTTTTGCCAAGAAATAA