Details for Lyrate rockcress Locus 16048887

Position : sca1 ( 5`- 7699156 .. 7697430 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048887

Protein [Map View]
MDLKKRRKILEKKKTIHDLIKRASSIDDPLSPFDSFRRYRRNDLSLYLESGRGDRLSSSVKQYIQKLLKTNMEGFYGSDW
PIQAKLKRKEMSSADAHYIFVRELRFGKAYEISTRRASMEQCNQIAGFVHYRFTLEEEIPVLYVYEIQLESRVQGKGLGE
FLMQLIELIASKNRMSAIVLTVLTSNALAMTFYTSILGYRISSISPSKANLLTFSAKYEILCKTFDAEAKFVLENDEEPT
KD*

DNA
ATGGATTTGAAGAAACGGCGAAAGATTTTGGAGAAGAAAAAGACGATTCATGACCTTATTAAACGAGCTTCTTCCATCGA
CGATCCTCTTTCTCCGTTTGATTCTTTCCGCCGTTACCGAAGAAACGACTTGTCTTTGTACCTGGAATCTGGCCGTGGAG
ATAGACTTTCCTCGTCTGTGAAGCAATACATTCAAAAGCTCTTGAAGACAAACATGGAAGGGTTTTATGGGTCTGATTGG
CCTATACAAGCAAAGCTGAAGCGTAAGGAGATGTCTTCCGCAGACGCACATTATATCTTTGTGCGTGAGCTGCGTTTTGG
TAAAGCCTATGAAATATCTACTCGAAGAGCTTCCATGGAACAGTGTAATCAGATAGCTGGATTTGTGCATTACCGGTTTA
CTTTAGAGGAAGAGATACCTGTCCTTTATGTGTATGAAATACAACTGGAATCCCGTGTTCAAGGAAAGGGACTAGGAGAA
TTTTTAATGCAGTTGATTGAGCTCATTGCTTCTAAGAATCGGATGAGTGCTATCGTGCTAACTGTTCTAACATCTAATGC
ATTGGCAATGACTTTCTACACGAGCATACTAGGATACAGAATATCAAGCATTTCGCCCTCGAAAGCTAATCTTCTGACTT
TCTCGGCGAAGTATGAGATACTTTGCAAAACATTTGATGCCGAAGCTAAATTTGTGTTGGAGAATGACGAAGAACCTACC
AAAGATTGA