Details for Lyrate rockcress Locus 16048868

Position : sca3 ( 5`- 8564375 .. 8563298 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048868

Protein [Map View]
MSLVCSSSCVAPLSQTRQSRPSFLKLETCTLSLCSPAGYPNFTRKHISYLFTEPLKLRWLAKSRILASQESFTETSTIDM
DWEDQEEIEDTGSPWEGSVMYRRNASATHVEYCTTLERLGLGRLSTEVSKKRASAMGLRVTKDVKDYPDGTPVQVSVDVI
RKKKKLRLDGIVRTVITLGCNRCGESTGESIFSNFSLLLTEDPVEEPDVIDLGFTFGGDKEEGEDDDDDDSWIDWEDTLH
FPPEVKEIDISKHIRDLVHLEITITAICDSACKGMCLKCGANLNKRKCDCGREEKDKGYGPLGNLREQMQQKEGLRN*

DNA
ATGTCTCTGGTTTGCTCTTCATCTTGTGTAGCTCCCTTATCACAGACTAGACAGTCGCGTCCAAGTTTTCTGAAACTCGA
AACATGTACCTTAAGTTTATGCTCTCCCGCCGGCTACCCTAATTTTACCAGGAAGCATATCAGTTACTTGTTCACAGAAC
CGCTTAAGCTTCGTTGGCTAGCAAAGAGTCGGATATTAGCTAGTCAGGAGTCTTTTACAGAGACCAGCACAATAGATATG
GATTGGGAAGATCAGGAGGAAATTGAGGATACTGGGTCACCTTGGGAAGGTTCGGTTATGTATAGGAGAAATGCTTCAGC
TACACATGTGGAATATTGCACTACCTTAGAGAGGCTTGGGTTGGGAAGATTGTCAACAGAGGTCTCGAAGAAGAGAGCTT
CCGCAATGGGACTAAGAGTGACAAAAGATGTAAAGGATTATCCAGATGGCACGCCGGTGCAAGTTTCGGTTGATGTCATA
AGAAAGAAGAAGAAACTGAGACTCGATGGAATTGTCAGGACTGTTATCACACTCGGCTGCAATAGATGTGGTGAGTCAAC
AGGTGAGAGCATCTTCTCCAACTTCTCGCTATTACTAACCGAAGATCCAGTTGAAGAACCCGATGTCATTGATCTAGGAT
TCACATTCGGAGGTGACAAAGAAGAAGGCGAAGATGATGATGATGATGATTCATGGATAGATTGGGAGGATACGCTTCAT
TTTCCACCTGAGGTGAAAGAAATAGATATCTCAAAGCATATAAGAGACTTGGTGCATTTAGAAATCACCATCACTGCGAT
ATGCGATTCTGCATGTAAAGGAATGTGCTTGAAATGCGGTGCGAATCTGAATAAGAGGAAATGTGATTGTGGCAGAGAAG
AGAAGGATAAAGGATATGGACCTCTCGGAAACCTGAGAGAGCAAATGCAACAAAAAGAGGGACTGAGGAACTAA