Details for Lyrate rockcress Locus 16048863

Position : sca3 ( 5`- 2041418 .. 2044523 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048863

Protein [Map View]
MEKNRVPDYKSYLSEFDHYVASEKMGSGNCKALCYGFEVGDMVWGKVKSHPWWPGQIFNEAFASPSVRRMKKMGYVLVAF
FGDNSYGWFDPAELLPFEPHVAENSQQTSSGHFAKAVEEAMDELGRRSALGLTCKCRNQYNFGPTNVQGYFAVDVPDYDL
QAVYSSKQIQKARDSFSSVQTLAFVKRCALAPQECDTDSLKSFQKKVAVCAFRRAVFEEFDETYEQAFGARSVYCLVKTH
EPFNRAPLRVPLTGSLVSAETLGNPKSSTKAMNVKDSTKHEKNLPKRREGAGDMTVQFGQVQESSQIQGSNRSSAGDHVL
QRRTPHTQTPRKHEQTGLVSMNFTSSSGNIPGKKSSVSKLSRDDDKGFTHEKFKAVKCLKQEETGTNSRSNEGSLQPFIG
GKFSAGVGIKKGNVVKRSSGEMESENGPPEPKKKKKESVSELNRDTPDKRKALSSGESWAKKSSQVDSAKRHSNRLIVRN
SKLDGLQMLSNLQALSLDYFFGSSDRSSIRAVRQFFLHFRSHVYQKSLATSPFTTVLSKSAKTLCRTNEPSKAGRNRISS
ENQQDVPSTKKLKKTIQFKPMASDKKTKQEATKRSTLATFNPVRDQGGPVPINAKPAIVQSEKKKAPSAMVVEPTMLVMM
FPPGTSLPSTALLKARFGRFGQLDQSAIRVSWKSSICRVIFKYKLDAQTALRYASGSNSIFGNVNVTYFLRDMKASSASG
DHEQKKAKADEPIIEPLNQWLEKAPPVHQPNIQLKSCLKKPGNNGNGNHRTVRVKFMLGEETETPFSVSGRNNGNYASSS
SSSVAMEYVSENTQNMVPSTLPPILPLSSQDSEPKPVNNQVNHVEPPINPSQLTVDISLQMMELLTRCNDVVSNVTCLLG
YVPYHFL*

DNA
ATGGAGAAAAATCGAGTTCCGGACTACAAATCTTACTTATCCGAGTTTGACCATTATGTTGCAAGCGAGAAAATGGGTTC
TGGAAATTGTAAGGCATTGTGCTATGGGTTTGAAGTGGGAGATATGGTATGGGGAAAGGTTAAGTCACATCCGTGGTGGC
CAGGTCAGATATTCAATGAAGCGTTTGCGTCTCCCTCTGTTCGTCGTATGAAGAAGATGGGTTACGTTCTGGTTGCTTTC
TTTGGAGATAATAGTTATGGCTGGTTTGATCCTGCTGAGCTTCTTCCTTTTGAACCTCATGTAGCAGAGAATTCGCAGCA
AACTAGTTCAGGTCACTTTGCAAAAGCTGTGGAAGAAGCTATGGATGAACTAGGTAGAAGGTCAGCTCTTGGGTTGACTT
GTAAGTGTCGGAATCAGTATAACTTTGGGCCTACTAATGTTCAAGGTTACTTTGCTGTAGACGTGCCTGATTATGATCTC
CAAGCTGTTTACTCTTCTAAGCAGATTCAGAAAGCTAGGGATAGTTTTTCATCTGTTCAAACTCTAGCTTTCGTGAAGCG
GTGTGCATTAGCACCTCAAGAGTGTGATACAGACAGCTTAAAGTCTTTCCAGAAGAAAGTAGCGGTTTGTGCATTCCGTA
GGGCAGTGTTTGAGGAGTTTGATGAAACATATGAACAAGCTTTCGGGGCAAGATCTGTATACTGTTTAGTGAAGACACAT
GAACCATTTAATAGAGCACCCCTTCGAGTCCCCTTGACTGGCTCATTGGTCAGTGCAGAAACTCTGGGCAACCCAAAGAG
CTCTACAAAAGCTATGAATGTAAAGGATTCTACTAAACATGAAAAAAATCTTCCCAAAAGAAGAGAGGGAGCTGGTGATA
TGACAGTTCAATTTGGCCAGGTCCAAGAATCTTCTCAGATTCAGGGCAGCAACAGATCTTCAGCTGGGGATCATGTACTG
CAGAGAAGGACTCCACATACCCAAACTCCCAGGAAACATGAGCAGACCGGGCTTGTCAGCATGAACTTCACCTCTTCAAG
TGGTAATATTCCTGGAAAGAAATCCTCTGTTTCAAAGCTCTCTCGGGATGATGACAAGGGTTTCACTCATGAGAAATTTA
AAGCAGTGAAATGCCTTAAACAAGAAGAGACTGGCACGAACTCTAGATCTAACGAAGGCTCTCTCCAGCCTTTTATTGGT
GGGAAATTTTCTGCAGGAGTTGGGATCAAGAAAGGCAATGTCGTGAAACGGTCTTCTGGCGAAATGGAATCTGAGAATGG
TCCTCCAGAGCCAAAGAAGAAGAAGAAAGAGTCTGTTTCAGAGCTGAACCGTGACACTCCAGATAAGAGGAAAGCTTTAT
CTTCTGGGGAATCTTGGGCCAAGAAATCATCACAAGTGGATTCAGCAAAGAGACACTCCAATAGGTTGATTGTGAGAAAC
TCTAAACTTGATGGTCTGCAGATGTTGAGTAATTTGCAAGCTCTCTCGCTTGACTATTTCTTTGGATCCTCAGATAGAAG
TTCTATTAGAGCTGTAAGGCAGTTCTTTCTTCATTTCCGATCACATGTTTACCAGAAAAGCTTGGCCACATCTCCGTTCA
CTACAGTACTGTCAAAATCTGCGAAGACTTTGTGCAGAACTAATGAACCATCAAAGGCTGGGAGAAACCGCATATCGTCT
GAGAATCAACAAGATGTCCCATCAACTAAGAAGCTAAAGAAAACCATTCAGTTCAAACCAATGGCTTCTGACAAGAAAAC
AAAGCAAGAAGCAACAAAGAGATCAACTCTTGCCACATTTAATCCAGTGAGAGACCAAGGTGGTCCAGTCCCCATCAATG
CCAAACCAGCTATAGTTCAATCAGAAAAGAAGAAGGCCCCATCTGCAATGGTAGTTGAGCCAACAATGCTGGTCATGATG
TTTCCTCCTGGTACATCTCTCCCTTCCACCGCTCTGCTTAAGGCGAGGTTTGGGCGCTTTGGACAGTTGGATCAATCAGC
CATCAGAGTTTCCTGGAAATCCTCGATATGCCGTGTTATCTTCAAGTATAAGCTCGATGCGCAGACTGCCTTAAGATATG
CATCAGGAAGCAACTCTATCTTTGGCAACGTGAATGTGACATACTTTCTCCGCGACATGAAAGCTTCTTCTGCATCCGGA
GATCATGAACAGAAGAAAGCCAAGGCAGACGAACCAATCATTGAACCATTGAACCAGTGGCTAGAGAAAGCACCGCCAGT
TCACCAACCAAACATCCAGCTCAAGTCGTGTTTGAAAAAACCAGGCAATAACGGTAATGGTAACCACAGAACAGTACGAG
TGAAATTCATGTTGGGTGAAGAAACAGAGACACCATTTTCGGTTTCGGGTAGAAACAATGGAAATTACGCTTCTTCTTCA
TCATCATCTGTTGCAATGGAATATGTTAGTGAGAACACTCAAAACATGGTTCCCTCAACATTACCTCCGATTCTTCCTCT
CTCTTCACAAGACTCAGAACCAAAGCCTGTTAATAATCAAGTGAACCACGTCGAGCCACCTATAAACCCGTCGCAGCTTA
CCGTGGACATTTCCCTGCAGATGATGGAACTGTTAACAAGGTGTAACGATGTTGTGTCTAACGTCACGTGTTTGTTGGGT
TACGTCCCTTATCATTTCTTATGA