Details for Lyrate rockcress Locus 16048811

Position : sca3 ( 5`- 7646847 .. 7650972 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048811

Protein [Map View]
MNFLLRSASSATHRPPVSEPPATPPQPPPETAKPGVTLEGLIAEESFPQYPSVEEDLDRLANGSRDDDGSGESNAKSGGS
GMDRFSDVSEEEGWIAIPYKEIPDNWSESVDIHSLRSLDRSFVFPGEQIQILACLSESKGDTEIITPFKVAEVMSRTGQR
KVFDKQNGDMSDGASTPSGDGEMSPDAQFATQNGDSPGKESLDSQKDLSDGESILRMEDHKRRTEDLLSRFQKSHFFVRI
AESGEPLWSKKSSLVADTDMDEKRKSTKSRPCVSAFVDRGDFDPNVAGGVARSKAKCCALPNGDIVVSLQVYIVDCPKEP
IIEILQFEKHQDKDQNSENDKDPYGNLLKWLIPLDNSISQQPRSLPPPITPSPGISSTAHKPAISSTSGSQLFSFGHFRS
YSMSALPPNTAPVTGPIKTQSSKPSFDIEDWDSYSGQTVRNGQKSGTEELLSFRGVALERNRFSVRCGLEGICIPGRRWR
RKLEIIQPIEINSFAADCNTDDLLCVQIKNVAPTHAPDIVIYIDAITIVFEEAGKNASPSSVPIACIEAGNEHSLPNLTL
RKGEEHSFIVKPAFSVGSNLKPSAARNKLKSSSLSLPTVNFERKGSGLSGDQYAVMVSCRCNYTESRLFFKQRTKWRPRV
SRDLMISVASEMSGEPCGPHGRASQLPVQILTLQASNLTSEDLSLTVLAPASFTSPPTVVSLNSTPTTPISPFLGFSEFT
ERVQNEKRNTTMRKHQSLPPIPLETRTENTNGESSNPSDVVPKSGLGCTHLWLQSRVPLGCVPSKSTATIKLELLPLTDG
IITLDTLQIHAKEKGRRYIPEQSLKINATSSISSGIF*

DNA
ATGAATTTCTTGCTTCGATCTGCTTCTTCCGCTACTCATCGGCCTCCGGTGAGCGAACCACCAGCTACTCCACCTCAACC
TCCGCCTGAAACAGCCAAGCCCGGAGTGACTTTAGAAGGGCTGATAGCTGAAGAGTCTTTCCCTCAATATCCATCAGTAG
AAGAAGATCTCGATCGTCTGGCTAACGGATCCAGAGATGATGATGGTAGTGGAGAGTCAAATGCTAAGTCTGGTGGCTCT
GGTATGGACAGATTCTCTGATGTGTCTGAGGAAGAAGGATGGATCGCCATTCCATATAAGGAGATCCCGGATAACTGGTC
TGAGTCTGTTGATATTCATTCTTTACGGTCGCTGGATCGTTCCTTTGTTTTTCCTGGGGAGCAGATTCAAATCCTTGCAT
GCTTATCTGAGAGTAAAGGAGACACCGAGATTATTACCCCTTTTAAGGTTGCTGAGGTAATGAGCAGAACTGGACAGAGA
AAGGTCTTTGACAAACAAAATGGGGATATGTCTGATGGGGCGAGTACACCATCAGGGGATGGAGAAATGAGTCCTGATGC
TCAATTTGCTACTCAGAATGGTGACAGTCCTGGTAAAGAGAGTTTGGATTCACAAAAGGACTTATCTGATGGTGAATCAA
TCTTGAGGATGGAAGATCATAAGAGACGAACAGAAGACTTGCTTTCCAGGTTTCAGAAGTCTCATTTCTTTGTTAGGATT
GCAGAGTCTGGTGAGCCTCTTTGGTCAAAGAAAAGTTCTCTGGTCGCAGATACAGACATGGATGAAAAGAGGAAAAGCAC
GAAAAGTAGACCTTGTGTTAGTGCTTTTGTAGATAGAGGAGACTTCGATCCTAATGTTGCTGGAGGTGTAGCTAGAAGTA
AGGCAAAATGCTGTGCCCTACCCAATGGAGATATAGTGGTCTCTTTACAAGTTTATATTGTCGACTGTCCCAAAGAACCC
ATCATAGAGATACTGCAGTTTGAGAAGCATCAAGACAAGGACCAAAATTCTGAGAACGATAAGGATCCATATGGGAATCT
TTTAAAGTGGTTAATACCGCTGGATAACAGTATTTCTCAGCAACCCCGTTCTTTACCACCTCCTATAACCCCTAGCCCAG
GTATCAGCAGCACTGCACACAAGCCAGCGATCTCTTCTACCTCAGGCTCTCAACTCTTCTCATTCGGCCATTTCAGAAGC
TACTCCATGTCCGCTCTACCTCCAAACACTGCACCAGTTACTGGACCCATAAAAACACAGAGCTCTAAACCATCATTTGA
TATTGAAGATTGGGACAGCTACTCAGGTCAAACGGTGCGAAATGGTCAGAAGTCTGGGACTGAAGAGCTCTTATCTTTTC
GGGGTGTCGCATTGGAGCGGAATAGGTTTTCTGTTCGTTGTGGACTCGAAGGCATCTGCATCCCTGGTAGAAGGTGGAGG
AGGAAACTCGAGATCATTCAACCTATTGAGATAAACTCTTTTGCAGCTGACTGCAATACAGATGATCTTCTCTGCGTTCA
GATAAAGAATGTGGCTCCTACCCATGCTCCAGATATTGTAATATACATAGACGCCATAACAATTGTTTTTGAAGAGGCAG
GAAAAAATGCTTCCCCTTCTTCAGTACCAATAGCATGCATTGAAGCTGGAAACGAGCACAGTTTGCCAAATTTAACTCTC
AGGAAAGGTGAGGAGCACTCATTCATCGTGAAGCCTGCGTTTTCTGTTGGGAGTAATCTGAAGCCCTCTGCTGCACGAAA
CAAACTCAAATCATCGAGTTTGTCTCTTCCAACTGTAAATTTTGAAAGAAAAGGGAGCGGTTTAAGTGGTGATCAGTATG
CGGTTATGGTGTCATGTCGGTGCAACTACACAGAATCAAGACTGTTTTTCAAACAACGGACAAAATGGAGACCACGAGTT
TCGAGAGACCTGATGATCTCTGTTGCGTCTGAAATGTCAGGAGAGCCTTGTGGTCCCCATGGGAGAGCCTCTCAACTACC
CGTTCAGATTTTAACTCTTCAGGCATCGAATTTGACTTCAGAAGATCTATCTTTGACCGTTCTCGCTCCTGCATCCTTCA
CATCACCTCCGACTGTAGTGTCCTTAAACTCTACGCCTACGACCCCTATAAGCCCATTCCTAGGATTCTCTGAGTTCACC
GAGAGGGTACAAAATGAGAAACGCAACACTACGATGCGTAAACATCAATCGTTACCCCCAATTCCACTGGAGACAAGGAC
AGAGAACACAAATGGTGAATCTTCCAATCCTTCAGATGTTGTTCCAAAGAGCGGCTTAGGTTGCACACATCTCTGGCTAC
AAAGTCGAGTTCCCTTGGGATGCGTTCCTTCGAAATCTACGGCGACGATCAAGCTAGAGCTACTCCCTTTGACTGATGGC
ATAATCACTCTTGATACTCTCCAGATCCATGCCAAGGAGAAAGGTCGTAGATACATTCCAGAGCAGTCACTGAAGATAAA
CGCAACTTCAAGCATTTCCTCTGGGATTTTCTAG