Details for Lyrate rockcress Locus 16048746

Position : sca3 ( 5`- 9551683 .. 9546890 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048746

Protein [Map View]
MVKAYLRYEAASSFGVISSVDSNITYDSTGKHVLAPALEKVGIWHVRQGVCTKTLNPSSSRGGPSLAVTSIASSASSLVA
VGYADGSIRIWDCEKGTCEVNFNSHKGAVTALRYNKVGSMLASGSKDNDVILWDVVGESGLFRLRGHRDQVTDLVFLDGG
KKLVSSSKDKFLRVWDLETQHCMQIVSGHHSEVWSVDADPEERFVVTGSADQELRFYAVKEYSSHGSLVSDSNANEIKTG
EEHSTENKWEILKPFGEIQRQTKDRVARVRFNVSGKLLACQMAGKTVEIFRVLDEAEAKKKAKRRLHRKEKKTSKVGDEN
LTANGEASTKIEQADTVSSPTVPDVFKLLQVIRAGRKISSFSFCPVTPKESLGTVALSLNNNSLEFYSLKSSENEKTVTI
EHQGHRSDVRSVTLSEDNTLLMSTSHSEVKIWNPSTGSCLRTIDSGYGLCSLIVPQNKYGIVGTKSGVLEIIDIGSATKV
EEVEAHGGTIWSITAIPNDNGFVTVSADHEVKFWDYQVKQKSGKATKQLTVSNVKSMKMNDDVLAVAISPDAKHIAVALL
DSTVKVFYMDSLKFYLSLYGHKLPVMCIDISSDGELIVTGSQDKNLKIWGLDFGDCHKSIFAHGDSVMGVKFVRNTHYLF
SIGKDRLVKYWDADKFELLLTLEGHHAEIWCLAVSNRGDFLVTGSHDRSMRRWDRSEEPFFLEVEKEKRLEELFESEIDN
EDRHGPMEEIPEEGVAAALAGKKTIDILSAADSIIDALEVAEDEKNRHAAYEEEKTKGKVPEYLPNAVMFGLSPTDYVLR
AISNVRTNDLEQTLLALPFSESLKFLCYMKDWSLIPEKVELVSRIATIILQTHHNQLVTTPSARPVLSVLRDILYSKIKA
CKDTIGFNLAAMDHVKQMMDSRSDAPFKDAKAKLMEIRSQQAKRMASRADTKMEKKRKKKQKKLEEGQHGHALF*

DNA
ATGGTGAAGGCTTACCTAAGATACGAGGCAGCGTCCTCTTTCGGTGTGATTTCATCTGTAGATTCGAACATAACTTACGA
TTCGACGGGGAAGCATGTACTTGCTCCGGCGTTGGAGAAAGTCGGAATCTGGCACGTCCGGCAAGGTGTCTGTACCAAAA
CCCTAAATCCTTCCTCCTCTCGCGGCGGACCATCTCTCGCCGTTACTTCCATCGCCTCCTCTGCTTCTAGTTTGGTGGCA
GTTGGGTATGCAGATGGGAGCATAAGGATATGGGATTGTGAGAAAGGAACCTGTGAGGTTAATTTCAATAGTCATAAGGG
GGCGGTGACTGCTTTGCGGTACAATAAGGTTGGATCGATGCTTGCGTCTGGAAGTAAAGATAATGATGTTATCTTGTGGG
ATGTTGTTGGCGAATCAGGCCTTTTTCGTCTCCGTGGACACCGTGATCAGGTCACAGATCTTGTATTCTTGGATGGTGGT
AAGAAACTTGTTAGTTCATCTAAGGACAAGTTCTTGAGAGTCTGGGATCTTGAGACCCAACACTGTATGCAAATAGTTAG
CGGTCATCATAGTGAAGTGTGGTCTGTTGATGCTGATCCAGAGGAGAGATTTGTTGTTACTGGGTCGGCTGATCAAGAGC
TTAGATTTTATGCTGTCAAGGAATACTCGTCTCATGGATCATTGGTATCTGATTCAAATGCAAATGAAATCAAGACCGGT
GAAGAACATTCGACCGAGAACAAGTGGGAAATTTTAAAGCCGTTTGGGGAAATTCAGAGACAAACTAAGGATAGAGTTGC
GAGAGTTAGATTCAATGTTTCGGGGAAACTTCTGGCTTGTCAAATGGCAGGTAAAACAGTTGAAATATTCCGGGTTTTGG
ATGAAGCTGAGGCTAAGAAGAAAGCAAAGCGCAGGCTTCACAGGAAAGAAAAGAAGACTTCCAAAGTGGGGGATGAAAAT
CTAACCGCTAATGGTGAAGCAAGTACTAAAATTGAACAAGCTGATACTGTTTCTAGTCCTACTGTCCCTGATGTGTTTAA
GCTTTTACAAGTCATTAGAGCTGGCAGAAAAATCAGCTCTTTCTCTTTTTGTCCAGTGACTCCAAAGGAATCCTTAGGAA
CAGTAGCTCTCTCTTTGAACAATAACTCCCTGGAATTCTATTCCCTTAAGAGCAGCGAAAACGAGAAAACTGTTACCATT
GAACACCAAGGACATCGCTCTGACGTGAGGAGTGTTACCCTCAGTGAAGACAACACCCTTTTGATGTCAACCAGTCATAG
TGAAGTGAAAATTTGGAATCCCAGTACAGGTTCCTGTCTCCGGACCATTGATTCAGGATATGGATTATGCAGTTTGATTG
TTCCTCAAAACAAGTATGGTATTGTTGGAACCAAGAGTGGGGTACTCGAAATCATTGATATAGGGAGCGCTACCAAAGTG
GAAGAAGTGGAGGCTCATGGTGGCACTATTTGGTCAATTACAGCTATTCCAAACGATAATGGGTTTGTCACTGTCAGTGC
AGATCATGAAGTCAAATTCTGGGACTACCAAGTCAAACAGAAATCTGGCAAGGCGACCAAGCAACTCACTGTTTCAAATG
TTAAGTCCATGAAGATGAATGACGATGTACTTGCTGTTGCTATCAGCCCTGATGCTAAACATATAGCAGTTGCACTGCTT
GATTCCACAGTGAAGGTTTTCTACATGGATTCCCTAAAATTCTACCTCTCCTTATATGGCCACAAGTTGCCTGTGATGTG
CATTGACATCTCATCAGATGGAGAGTTGATTGTAACTGGTTCTCAGGACAAAAATTTGAAAATTTGGGGTTTGGATTTTG
GTGATTGTCATAAGTCTATCTTTGCTCATGGTGACAGTGTTATGGGTGTTAAATTTGTTCGGAATACCCATTATCTATTC
AGCATTGGGAAAGACCGCCTCGTCAAGTATTGGGATGCTGACAAATTCGAGCTATTGTTAACGCTTGAAGGACATCATGC
AGAGATTTGGTGCCTTGCTGTCAGTAACCGTGGTGATTTTCTCGTAACAGGATCTCATGACCGCTCTATGCGTCGCTGGG
ATCGCTCTGAAGAACCTTTCTTCCTCGAGGTAGAGAAAGAAAAGAGGTTAGAAGAGCTTTTTGAGTCTGAGATTGATAAT
GAGGACAGGCATGGACCCATGGAGGAAATTCCAGAGGAAGGTGTTGCAGCAGCATTAGCTGGCAAGAAGACGATAGATAT
TCTATCAGCTGCTGATTCAATCATAGATGCTCTGGAAGTAGCAGAAGATGAAAAGAATCGTCATGCTGCTTATGAGGAGG
AGAAAACAAAGGGAAAAGTTCCTGAATACCTACCCAACGCTGTGATGTTCGGGCTTTCTCCGACCGATTATGTTCTCAGG
GCCATCTCAAATGTGAGAACAAATGATCTTGAGCAGACTTTGCTGGCTCTACCATTCTCAGAATCTTTGAAGTTTCTTTG
CTACATGAAAGACTGGAGTTTAATTCCCGAAAAGGTAGAGTTGGTTTCCAGAATCGCAACCATTATATTACAGACACATC
ACAACCAGTTGGTAACAACACCGTCTGCCAGACCAGTCTTGAGCGTTCTCAGGGATATTCTGTACTCAAAAATCAAGGCA
TGCAAAGATACAATCGGGTTCAATTTGGCCGCCATGGATCATGTCAAGCAAATGATGGACTCAAGATCTGATGCTCCCTT
CAAAGATGCAAAGGCCAAGCTAATGGAGATAAGGTCACAGCAAGCGAAACGTATGGCATCACGAGCAGATACAAAGATGG
AGAAAAAGAGAAAGAAGAAGCAAAAGAAATTAGAGGAAGGACAACATGGCCATGCTTTGTTCTGA