Details for Lyrate rockcress Locus 16048690

Position : sca3 ( 5`- 5529808 .. 5528547 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048690

Protein [Map View]
MQQQVYFPSDHPRHIFEESPCESGDAICKLCKNLEEEPEPEVDPEVDLAALVEIDGKSKRHFSHEHDLLRLDMDEEEEKS
EQVCQACVLPIPFGSFFQAMRLCSPRVV*

DNA
ATGCAGCAACAAGTGTATTTCCCATCTGATCACCCTAGACACATATTTGAAGAATCTCCATGCGAATCTGGAGATGCAAT
TTGCAAATTGTGTAAAAATCTTGAAGAAGAACCTGAACCAGAAGTTGACCCTGAAGTTGATCTTGCTGCATTGGTGGAAA
TAGATGGAAAATCAAAACGTCATTTTAGCCATGAACATGACCTATTGAGACTCGATATGGACGAAGAAGAAGAAAAAAGT
GAACAAGTATGTCAAGCCTGCGTCCTTCCAATTCCATTTGGTAGTTTCTTTCAAGCAATGCGACTTTGCTCTCCACGAGT
TGTGTGA