Details for Lyrate rockcress Locus 16048666

Position : sca3 ( 5`- 1885341 .. 1889451 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_340683 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048666

Protein [Map View]
MEGENRSIIEKGLLLVNKEESANTTPLLVFTTFIIVSASFSFGVALGHTAGTMASIIEDLDLSITQFSVFGSLLTFGGML
GAIFSATIADSFGCKMTLWISEVFCISGWFAIALAKNIIWLDLGRFFVGIGVGLLSYVVPVYIAEITPKTVRGTYTFSNQ
LLQNCGVATAYYLGNFISWRIIALIGILPCLIQLVGLFFVPESPRWLAKEGRDEECEVVLQKLRGDEADIVKETREIMIS
VDASANISMRSLFKRKYSHQLTIGVGLMLLQQLSGSAGLGYYVGSVFDLAGFPSRIGMTVLSIVVVPKAILGLILVERWG
RRPLLMASAFGLCLGCISLALAFGLKGVPGINVNVTPTLAFIGILTFVMMFAAGLGALPWIIMSEIFPMDMKVVAGSLVS
ITNWFTGWIVSYCFNFMLLWSPTGTFIIFATICGATIVFAWCLVPETRGLTLEEIQLRRAH*

DNA
ATGGAGGGAGAGAATAGGAGCATTATTGAGAAAGGATTATTATTGGTAAATAAGGAAGAGAGTGCAAATACAACTCCACT
TCTTGTCTTCACCACTTTCATCATTGTCTCTGCCTCCTTCTCTTTCGGCGTTGCCTTAGGGCATACTGCTGGTACAATGG
CCTCCATTATTGAAGATCTTGATCTTTCTATCACACAATTTTCTGTATTTGGTTCGTTGTTGACATTTGGAGGAATGTTG
GGTGCAATATTTAGCGCCACGATTGCAGATTCATTTGGTTGTAAAATGACTTTGTGGATCTCTGAGGTATTCTGCATAAG
TGGATGGTTTGCAATTGCACTAGCCAAGAATATTATTTGGCTGGACTTGGGACGATTCTTTGTAGGAATTGGAGTTGGTC
TCCTTAGTTACGTGGTTCCTGTATATATTGCAGAAATAACTCCCAAAACTGTGCGAGGCACTTATACATTTAGTAATCAG
TTGTTGCAAAATTGTGGGGTGGCAACCGCGTATTACCTAGGAAATTTCATATCATGGAGAATCATAGCCTTAATCGGCAT
ACTTCCATGCTTGATACAACTTGTTGGATTGTTTTTCGTCCCCGAGTCTCCAAGATGGTTGGCAAAAGAAGGTCGTGACG
AAGAATGTGAGGTTGTTCTTCAGAAATTAAGAGGAGACGAAGCGGATATTGTGAAGGAAACTAGAGAAATCATGATTTCT
GTTGATGCTTCCGCGAATATCAGCATGCGTAGTCTTTTCAAAAGGAAATATTCTCATCAACTTACAATCGGTGTAGGTTT
GATGCTTCTGCAACAGTTAAGTGGAAGTGCAGGATTAGGTTATTACGTTGGTAGCGTGTTTGATCTTGCCGGATTTCCTT
CTCGGATTGGGATGACGGTGTTGTCTATTGTCGTGGTACCAAAAGCTATATTGGGTCTGATACTTGTGGAACGATGGGGA
AGAAGACCGCTTCTTATGGCATCGGCATTTGGGTTATGTTTAGGTTGTATCTCTCTTGCATTAGCGTTTGGATTGAAAGG
TGTCCCTGGGATTAATGTAAATGTTACTCCCACTTTGGCATTTATAGGAATATTGACATTTGTTATGATGTTCGCGGCTG
GATTAGGAGCGCTACCATGGATTATAATGTCTGAGATATTTCCGATGGACATGAAAGTAGTAGCTGGAAGTTTAGTAAGC
ATAACGAATTGGTTTACTGGTTGGATCGTCAGCTACTGTTTCAATTTTATGCTTCTTTGGAGTCCAACCGGAACTTTTAT
CATATTTGCTACGATATGTGGAGCAACGATTGTCTTCGCATGGTGTTTGGTGCCTGAGACTCGAGGTTTAACTTTAGAAG
AAATCCAACTTCGACGTGCTCATTAA