Details for Lyrate rockcress Locus 16048622

Position : sca3 ( 5`- 5769976 .. 5768900 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048622

Protein [Map View]
MEITWEKPISSSHHRHPSFSSTLLDQIYRSIDDSSPPPLESIKKKKHHHQQRNASLHEDREVSPVYHRRSIAADYERSRR
KTDFLRHSNSNSSDSSGGGFSSSESDSFYGRSKSSSSPPPGKQPKPIRTSSVDHSSAVQKPKELGGFLRTKSKALKIYSD
LKKVKQPISPGGRLATFLNSLFTNAAATNPKKHKKTTTTVEEPHSSSTCSSASSYSRSCLSKTPSSSGKSKRSVRFCPVN
VILDEDSSIHMPYAYNNNSLYGSNEAKRDVIEEHRRVIEAAKDLLRTYHNKNKVTTTTNITNVEEDDEDDAASCASSDLF
ELENLSAIGIDRYREELPVYETTRLDNMNRVIATGLIV*

DNA
ATGGAGATCACTTGGGAGAAACCTATTTCTTCATCTCACCACCGTCACCCTTCTTTCTCCTCCACTCTCCTCGACCAAAT
CTACCGCTCCATCGACGATTCCTCCCCTCCTCCCCTCGAATCCATCAAGAAGAAGAAGCATCACCACCAACAACGTAACG
CTTCTCTCCACGAGGATCGTGAAGTCTCTCCAGTCTATCACCGCCGCTCAATTGCCGCTGATTACGAGAGATCCAGGAGG
AAGACTGACTTTCTGAGACACTCCAACTCTAACTCTTCTGATTCAAGCGGCGGCGGATTCTCCTCTTCCGAGTCTGATTC
CTTCTACGGACGTTCCAAATCCTCCTCCTCTCCTCCTCCTGGAAAACAACCGAAGCCGATTCGAACATCATCCGTCGACC
ACTCCTCCGCCGTCCAGAAACCTAAAGAACTCGGTGGCTTCTTGAGAACGAAATCAAAAGCTTTAAAGATCTACTCCGAC
TTGAAAAAAGTCAAACAACCGATCTCTCCCGGTGGCCGACTCGCTACTTTCCTTAACTCTCTTTTCACCAACGCAGCCGC
CACTAACCCTAAGAAGCACAAGAAAACTACAACCACCGTTGAAGAACCACACTCCTCCTCCACATGCTCCTCCGCATCCT
CCTACTCCAGGTCTTGCTTGAGCAAAACTCCATCGTCTAGCGGCAAATCAAAAAGATCCGTACGGTTCTGTCCAGTAAAT
GTCATCCTCGACGAAGATTCCTCCATTCACATGCCTTACGCTTATAACAACAACAGTCTCTACGGTAGCAACGAAGCTAA
ACGCGACGTTATAGAAGAGCATCGCCGTGTTATCGAAGCAGCCAAAGATCTTCTTAGAACTTACCATAATAAGAACAAGG
TTACAACGACGACGAACATCACCAACGTAGAAGAAGATGATGAAGACGATGCTGCGAGTTGTGCAAGCTCTGATCTATTC
GAGTTGGAGAATCTTTCGGCGATTGGGATCGATAGGTATAGAGAAGAGCTTCCGGTTTACGAAACCACTCGTCTGGATAA
TATGAATCGAGTCATTGCTACTGGTTTAATTGTATAA