Details for Lyrate rockcress Locus 16048489

Position : sca3 ( 5`- 8653677 .. 8656533 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16048489

Protein [Map View]
MENNNGHVGNVVVTAEQATKINETDGRLPENRQTGVVSDTGSGSERGEQGDGETPVPVPVTVEESGSILVGDLPAPRSSS
ARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFDDPENEDEDDDEDEYETDDDPQEDA
PVVDVHANEDDQEDDGNSDIEEVAYSDDEAYARALQEAEERDMAARLSALSGLANRVVEDLEDDSHTSQDAWDEMDPDEL
SYEELLALGDIVGTESRGLSADTIASLPSKRYKEGDNQNGTNESCVICRLDYEDDEDLILLPCKHSYHSECINNWLKINK
VCPVCSAEVSTSTSGQG*

DNA
ATGGAGAACAACAATGGCCACGTTGGCAACGTCGTCGTCACCGCCGAGCAAGCCACCAAGATTAACGAGACTGATGGACG
GTTACCGGAGAATCGGCAGACCGGTGTTGTCTCAGACACCGGAAGTGGTAGCGAGAGAGGAGAGCAAGGGGATGGAGAGA
CGCCAGTGCCGGTGCCGGTGACGGTGGAGGAGAGCGGATCGATTTTGGTGGGAGACCTACCTGCTCCCCGATCTTCCTCC
GCTAGAGTTCCGTTCACTAATCTAAGCCAAATTGATGCAGATCTTGCTCTTGCTCGCACACTCCAAGAACAGGAGCGGGC
GTATATGATGCTGACCATGAACAGTGAAATCAGTGACTATGGGAGCTGGGAAACTGGAAGCTATGTATACGATGAGGATG
AGTTTGATGACCCTGAGAATGAGGATGAGGATGACGATGAAGACGAATATGAAACAGATGATGATCCTCAGGAAGATGCG
CCCGTTGTCGATGTGCACGCTAATGAAGATGATCAAGAAGATGACGGCAACTCTGACATCGAAGAAGTTGCTTATTCAGA
TGATGAGGCCTATGCTAGAGCTCTTCAAGAAGCTGAAGAAAGGGATATGGCAGCTAGATTGTCTGCCTTATCTGGGTTAG
CAAATCGGGTGGTTGAAGATCTAGAGGATGACAGTCATACTTCTCAGGATGCCTGGGATGAGATGGATCCTGATGAGCTT
TCTTACGAGGAGTTGCTTGCACTTGGCGACATTGTGGGAACTGAAAGTAGAGGATTGTCTGCTGATACAATTGCATCTTT
GCCTTCAAAAAGATATAAAGAAGGAGACAATCAGAACGGAACCAATGAGTCATGTGTTATATGTCGTTTAGACTATGAGG
ATGACGAAGACCTGATACTGCTCCCATGCAAACATTCTTACCACTCGGAGTGCATAAACAACTGGTTGAAGATAAACAAG
GTTTGCCCCGTATGCAGTGCAGAAGTTTCAACTTCCACCTCTGGACAAGGCTGA