Details for Lyrate rockcress Locus 16048455

Position : sca3 ( 5`- 4997200 .. 4999329 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478603 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048455

Protein [Map View]
MRKKLDTRFPAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLERGAKTVSSLHLKHCVERYNVFDFL
REVVSKVPDYGHSQGQGHGDVTMDDRTISKRRKPINDEVNDSDEEYKKSKTQEMGNAKPSGRGGRGRGRGRGRGGRAARA
AEREGLNREMELEAAVSGQPPPEDNIKMHVSESSPQENEKKDIDGTVASNEDNKQHLQSPKEGIDFDLNAESLDLNETKL
APATGATTTAATTDSEEYSAWPMMDIGKMDPAQLASLGKRIDEDEEDYDEEG*

DNA
ATGAGGAAGAAGCTCGATACTCGGTTCCCAGCTGCTCGAATTAAAAAGATTATGCAAGCTGATGAGGATGTTGGCAAGAT
AGCTTTGGCAGTGCCTGTCTTAGTCTCAAAATCTTTGGAATTGTTCTTGCAAGACCTTTGCGATCGTACATATGAGATTA
CCCTTGAAAGAGGAGCCAAGACCGTGAGCTCATTGCACCTAAAACATTGTGTGGAAAGATATAACGTGTTTGATTTTCTG
AGGGAAGTTGTGAGCAAGGTGCCTGACTATGGCCATTCGCAAGGGCAGGGCCATGGTGATGTCACCATGGATGATCGCAC
CATCTCCAAGAGAAGGAAGCCCATCAACGATGAAGTGAATGACAGCGACGAGGAATATAAGAAAAGCAAAACGCAAGAGA
TGGGGAATGCTAAGCCCAGTGGCAGGGGTGGTAGAGGAAGAGGGCGAGGAAGAGGTCGTGGTGGACGAGCTGCAAGAGCA
GCCGAAAGAGAGGGTCTCAACCGCGAGATGGAACTAGAAGCTGCTGTATCGGGACAGCCACCTCCAGAAGACAATATCAA
GATGCATGTGTCAGAGTCATCACCACAAGAGAATGAGAAGAAAGACATCGATGGCACAGTAGCATCAAACGAAGACAACA
AGCAACACCTTCAAAGTCCAAAAGAAGGCATTGACTTTGATCTCAACGCTGAATCCCTCGACCTAAACGAGACCAAACTG
GCACCAGCCACTGGCGCAACCACAACCGCAGCAACAACGGACTCAGAGGAATATTCGGCCTGGCCTATGATGGACATTGG
CAAAATGGATCCAGCACAGCTTGCCAGTCTGGGTAAGAGGATAGACGAGGATGAGGAAGATTATGACGAAGAAGGCTAA