Details for Lyrate rockcress Locus 16048439

Position : sca3 ( 5`- 3415791 .. 3418356 -3` )
Annotation : [B2G] kh domain-containing protein
External links : CoGe
PGDD synteny : 16048439

Protein [Map View]
MSGLYNYNFSPSRAASPQIRTTSSDVDSQYLSQLLAEHQKLGPFMQVLPICSRLLNQEIFRITGMLPNQGFTDFDRLRHR
SPSPMASPNLMSNAPGAGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSYPVKRILRLDLPVDTYPDFNFVGRLLGPRGN
SLKRVEATTGCRVYIRGKGSIKDPDKEEKLKGKPGYEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVDESHDY
IKRQQLRELALLNSNLRENSPGPSGSVSPFNSNAMKRPKTGR*

DNA
ATGTCTGGTCTGTATAATTATAACTTCTCACCTTCTCGAGCCGCTTCTCCCCAGATTAGAACCACTTCCTCCGATGTTGA
CAGTCAATACTTATCTCAATTGTTAGCAGAGCATCAAAAGCTTGGACCTTTCATGCAAGTCTTACCTATATGTAGCCGAC
TTTTAAATCAAGAAATTTTTCGGATCACCGGAATGTTGCCAAACCAAGGGTTTACCGATTTTGATAGGTTGCGGCATCGA
AGTCCTAGTCCAATGGCTTCACCAAATCTAATGTCTAATGCTCCCGGTGCTGGATTAGGTGGTTGGAATGGTCTTCCACC
AGAGAGAATAGGTGGTCCTCATGGAATGGCAATGGAGTGGCAAGGTGCGCCTGCTAGCCCAAGTTCATACCCAGTGAAGC
GTATCTTGCGTTTAGATCTTCCAGTTGATACCTATCCGGATTTCAATTTTGTTGGAAGGCTTCTGGGTCCTAGAGGGAAT
TCGTTGAAGCGTGTGGAAGCAACTACGGGTTGCCGTGTGTATATTAGAGGGAAAGGATCAATTAAGGATCCTGACAAAGA
AGAGAAACTGAAAGGGAAGCCTGGCTATGAGCATCTCAATGAGCAGCTGCATATCCTCATTGAGGCTGATCTTCCAATTG
ATATTGTGGATATAAAGCTGCGGCAGGCCCAAGAAATTATTGAGGAGTTGGTCAAGCCCGTGGATGAGTCACATGATTAC
ATCAAGAGGCAGCAGTTGCGAGAGCTCGCGTTACTGAATTCAAACTTGAGAGAAAACAGTCCAGGGCCGAGCGGTAGTGT
CTCTCCTTTCAATTCAAATGCAATGAAACGGCCAAAAACAGGGCGCTAA