Details for Lyrate rockcress Locus 16048425

Position : sca3 ( 5`- 7274320 .. 7276416 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898035 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048425

Protein [Map View]
MKPKSKVAESAAASCFLVMSLICSSINGEQAETNYEGLSYSYYEKTCPKVEEIVRSSLSSMFILDPTSPAALLRLMFHDC
QVQGCDASILLEPSGDQQFTELDSAKNFGIRKRDLIGSIKTSLELECPKQVSCSDVIILAARDAVALTGGPLIAVPLGRK
DSLSTPSKHVADSKLPPSTADVDTTLNLFASKGMTIEESVAIMGAHTIGVTHCNNVLSRFDNANATSENMDPRFQTFLRV
ACPEFSPTSQAAEATFVPNDQTSVIFDTAYYDDAIAGRGNLRIDSEIGADPRTRPFVEAFAADQDRFFNAFSSAFVKLSS
YKVLTGSEGVVRSVCDKAD*

DNA
ATGAAACCAAAGAGCAAAGTTGCAGAATCCGCAGCTGCATCATGTTTTCTTGTCATGAGCTTGATATGCAGCTCCATTAA
TGGTGAGCAAGCGGAGACGAATTATGAAGGATTATCTTACAGTTACTACGAGAAGACTTGTCCTAAAGTCGAAGAGATCG
TGAGATCTTCTCTTTCATCAATGTTTATACTTGACCCTACTTCTCCTGCAGCCTTGCTAAGGCTTATGTTTCATGACTGC
CAAGTTCAGGGCTGTGACGCATCAATCCTACTCGAGCCAAGTGGGGACCAACAATTCACTGAGCTTGATTCAGCCAAGAA
CTTCGGAATCAGAAAGAGGGACCTGATTGGCTCTATCAAAACCTCACTGGAGCTTGAGTGTCCCAAGCAAGTCTCATGCT
CCGACGTCATCATCCTCGCCGCCAGAGACGCCGTGGCTCTCACGGGAGGTCCACTCATCGCTGTGCCATTAGGACGAAAA
GACTCTCTCTCTACTCCAAGCAAACACGTGGCAGACTCTAAGCTTCCTCCCTCCACTGCTGACGTGGACACTACCTTAAA
CCTCTTTGCAAGCAAAGGCATGACCATTGAAGAGTCCGTAGCCATCATGGGTGCACATACGATAGGAGTCACACATTGCA
ACAACGTATTATCGCGTTTCGATAACGCAAACGCGACAAGTGAGAACATGGATCCACGTTTTCAAACGTTTTTGCGTGTG
GCTTGTCCAGAGTTTTCTCCAACTTCTCAAGCTGCGGAAGCCACATTTGTCCCCAACGATCAAACTTCAGTGATCTTCGA
TACAGCTTATTACGATGATGCAATCGCGGGACGTGGAAATCTTAGAATTGACTCGGAGATTGGAGCTGATCCACGTACAC
GTCCGTTTGTCGAAGCGTTTGCGGCTGACCAAGACCGCTTCTTCAACGCTTTCTCTTCCGCGTTTGTAAAATTGTCGTCT
TACAAAGTGTTAACCGGGAGTGAAGGAGTAGTTAGAAGCGTATGTGACAAGGCTGACTGA