Details for Lyrate rockcress Locus 16048415

Position : sca3 ( 5`- 8775683 .. 8773834 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048415

Protein [Map View]
MEALYAKLYDKYSKLKKKKFSEYDEVNREQEEKFLNFVSASEELMEHLRGENQNLLEIVEKIRNEMTSIRHVHHILRSGR
DDKCLEYQKLLREEEQKNKALSEEVVKLKELVKEGHPRNYEDQSGRKQETKTPETARVTTRSMRKRSRLSEDMVETDIVS
PQISKHHKAKETLLVSQPQCCKTTYDGSSSSASCTFQALGEHLLGMKLSTNNEGEHVCIVASHPTTGLSFSLTFINNPIG
EESELLYEVVSLGTFQRVAPEWMREVIKFSTSMCPVFFARVSRVIKLYC*

DNA
ATGGAAGCTCTCTACGCCAAGCTCTACGACAAATACTCCAAACTCAAGAAGAAGAAATTCTCCGAATACGATGAGGTTAA
TAGGGAACAAGAAGAGAAATTCCTTAATTTTGTTTCAGCCTCGGAGGAATTGATGGAACATTTGCGAGGTGAAAATCAGA
ATTTGCTGGAGATAGTGGAGAAAATTAGGAATGAAATGACTTCAATCAGGCATGTACATCATATATTACGATCTGGCAGG
GACGACAAGTGTTTGGAGTATCAAAAGCTTCTCAGGGAAGAAGAACAAAAGAACAAAGCACTTTCTGAAGAAGTTGTCAA
GCTAAAAGAGCTGGTGAAAGAGGGACATCCTCGCAACTACGAAGATCAAAGTGGAAGAAAACAAGAGACAAAGACACCTG
AAACTGCTCGAGTTACAACGAGAAGCATGAGAAAACGTAGCAGACTGTCAGAAGATATGGTGGAAACGGACATAGTATCA
CCTCAGATTAGCAAACATCATAAAGCAAAGGAAACTCTCTTGGTTTCTCAGCCACAATGCTGCAAAACAACCTACGATGG
ATCAAGTAGTTCTGCTAGTTGTACATTTCAAGCTCTTGGCGAACACTTGCTAGGAATGAAATTGTCGACTAATAATGAAG
GCGAACACGTCTGCATTGTAGCCTCACATCCAACAACCGGTTTATCCTTCAGCCTAACTTTTATAAATAACCCAATTGGT
GAAGAATCTGAGCTGCTCTATGAGGTTGTATCGCTCGGAACATTCCAAAGAGTGGCACCGGAATGGATGAGAGAGGTTAT
AAAGTTCAGCACAAGTATGTGTCCGGTCTTCTTTGCAAGAGTCTCTCGAGTCATTAAGCTCTATTGTTGA