Details for Lyrate rockcress Locus 16048395

Position : sca3 ( 5`- 2410461 .. 2409145 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477906 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048395

Protein [Map View]
MAMSILKLRNLSALRSAANSARIGVSSRGFSKLAEGTDITSAAPGVSLQKARSWDEGVSSKFSTTPLSDIFKGKKVVIFG
LPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVVCVSVNDPYAINGWAEKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAAL
LGPRSERWSAYVEDGKVKAVNVEEAPSDFKVTGAEVILGQI*

DNA
ATGGCGATGTCAATTCTAAAGCTAAGAAATTTATCGGCTTTAAGATCGGCCGCAAATAGTGCCCGGATCGGAGTTTCCTC
GAGGGGTTTCTCAAAGCTTGCGGAGGGCACTGACATAACCTCGGCGGCTCCCGGCGTCTCTCTCCAGAAAGCTCGGAGCT
GGGACGAAGGCGTTTCCTCCAAATTCTCCACCACACCATTGTCAGATATCTTCAAGGGGAAGAAAGTCGTCATTTTTGGA
CTTCCTGGGGCTTACACGGGAGTTTGTTCGCAGCAGCATGTGCCTAGCTACAAGAGCCACATTGATAAGTTTAAGGCTAA
AGGCATTGATTCTGTCGTATGTGTCTCTGTTAATGATCCCTATGCTATCAATGGTTGGGCTGAGAAGCTTGGTGCCAAAG
ATGCAATTGAGTTTTATGGGGATTTTGATGGGAAATTCCACAAAAGCTTGGGGCTAGACAAGGATCTCTCTGCTGCATTA
CTCGGGCCACGGTCTGAGAGATGGTCGGCTTATGTAGAAGACGGTAAGGTTAAGGCGGTGAATGTGGAAGAAGCACCGTC
TGACTTCAAGGTTACAGGGGCAGAAGTCATCTTAGGACAGATCTAA