Details for Lyrate rockcress Locus 16048387

Position : sca3 ( 5`- 9295292 .. 9297430 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048387

Protein [Map View]
MNAPIIDPLQGDFPEVIEEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKEIRDNDCSAAITSVSWSKYGH
RLLVSAADKSLTLWDVSTGEKIARTILQQTPLQARLNPGLSSPSLCLACPLSSAPMIVDFDIDCTTLLPVAVPEMPDVLA
PPQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVPVPGAAPVKNIVFSRNGQYLLTNSHDRTI
RIYENLLPAKNVLRSLEDLGKNIDGLDGVEKMKTVGSKCLTLFREFQDSVTKMHWKAPCFSGDGEWVVGGSACKGEHKIY
IWDRAGHLVKILEGPKEALIDLAWHPVHPIIVSVSLAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPET
EKVKVLDVNEDEEVDIETVEKDAFSDSDMSVEELRYLPAEPIPDTNDQLDNLVESIKLIEGQISASPASEEAGQNGHHAS
SPQGDDVVTNAWLSIAEEMGETRGKRKRKPSEKAMELQAEKAKPLKGSGRTVRAKGRAGVDQETDDSINGDDDDDDDAYY
*

DNA
ATGAACGCTCCGATCATAGATCCATTGCAAGGAGATTTTCCGGAGGTGATTGAAGAATATCTGGAACATGGTGTCATTAA
ATGTGTTGCCTTTAACCACCGTGGTTCTCTTCTCGCTGCGGGATGTGCCGATGGGGGATGTGTAATCTGGGATTTCGAAA
CTAGAGGCATTGCAAAGGAGATTCGTGATAATGATTGTTCTGCTGCTATAACAAGTGTCTCCTGGTCCAAATATGGGCAC
CGCTTGCTTGTGTCTGCTGCAGACAAGTCATTAACTCTTTGGGATGTCTCTACCGGAGAGAAGATTGCTCGTACGATTCT
TCAGCAGACTCCGTTGCAAGCTCGTTTAAACCCTGGCTTGAGTTCTCCTTCTCTCTGTCTGGCGTGCCCGCTCTCTTCTG
CTCCGATGATTGTTGACTTTGATATTGATTGTACAACTTTGCTTCCAGTCGCTGTGCCTGAGATGCCTGATGTATTAGCT
CCTCCACAACGCAGTAAATGTCCTGAATCAAATCCTCCTTTCTCTCCAGCTGCAGCATGCTTTAACAAGTGTGGGGATCT
TGTTTATATAGGTAATTCCAAAGGAGAAATACTTATAGTTGATTATAAAAGTGTTCGAGTTCTTGCTTTGGTTCCTGTGC
CTGGCGCGGCACCTGTGAAAAACATAGTGTTTAGCAGGAATGGGCAGTATCTTCTCACGAATTCACATGATCGAACCATT
AGGATATATGAAAATCTTCTCCCAGCAAAAAATGTGCTTAGATCCCTTGAGGACTTGGGAAAGAACATAGATGGGCTTGA
TGGTGTTGAGAAAATGAAGACTGTTGGATCAAAATGCTTAACACTCTTCAGGGAATTCCAAGATTCAGTTACAAAAATGC
ATTGGAAAGCGCCTTGTTTCAGTGGTGATGGTGAGTGGGTAGTTGGGGGTTCTGCGTGCAAAGGGGAACATAAGATCTAC
ATATGGGATCGAGCGGGGCATCTTGTGAAAATTTTAGAAGGTCCTAAAGAAGCGTTGATTGATCTAGCTTGGCATCCTGT
TCATCCCATAATCGTCTCTGTTTCCTTGGCGGGTCTAGTATATATTTGGGCAAAAGATTACACAGAGAACTGGAGTGCAT
TTGCTCCGGATTTCAAGGAGCTTGAGGAGAACGAAGAGTATGTGGAACGCGAAGATGAATTTGATTTGATACCTGAGACA
GAAAAGGTGAAAGTATTAGATGTTAATGAAGATGAAGAAGTTGACATAGAGACAGTGGAAAAGGATGCTTTTAGTGATTC
AGATATGTCAGTGGAGGAACTCCGCTACCTTCCAGCTGAACCGATCCCAGATACAAATGACCAGCTAGACAATTTGGTTG
AAAGCATCAAGTTAATTGAAGGTCAGATATCTGCATCTCCCGCTTCTGAAGAGGCTGGTCAGAATGGACACCATGCATCA
AGTCCACAAGGAGATGATGTCGTTACTAATGCATGGCTCTCTATTGCAGAAGAAATGGGTGAGACACGAGGAAAGAGAAA
AAGGAAACCATCAGAGAAAGCCATGGAGCTGCAGGCAGAGAAGGCAAAACCATTGAAAGGGTCAGGCAGAACAGTAAGAG
CAAAAGGCAGAGCAGGGGTTGATCAAGAAACCGATGACAGCATAAATGGCGATGATGATGATGATGATGATGCATATTAT
TAA