Details for Lyrate rockcress Locus 16048378

Position : sca3 ( 5`- 8604822 .. 8602197 -3` )
Annotation : [B2G] phototropic-responsive nph3 family protein
External links : CoGe
PGDD synteny : 16048378

Protein [Map View]
MSLLCDLQINLNNQFTFFVNQDLISEYSGFLRKMIKQSNKKKKNHKNSRIIIEVEDFPGGSDGFDLVSRFCYGNGGGISI
DVSNVSILHCSSVFLEMTEKLCSSNLLLQTDKFLEGMFYWSWNDIVLCLKSCEQVFLHADSYGLVDKLVFGVLAKIAQNS
DMSHVFSSSSPSSSASASSHSPETARNRSDSDKRSTSRSLSCRTSNEWWFDDMSILGPKIIEKVMKTLGAHDKNNDSLVL
TRFLLHYLKTKVQNKSNNKLEYAGLADTAVRGVVFAAKTAFSCRKMFWVLRVLSGFSISKESRIGLERVIGEMLDQATLD
DLLIPAGGKKEKGFYDVDLVIRLLKVFVRTGNTEEEQNLKMRRIGKLIDKYLREISPDQNLKESKFLEVAESLPDSARDW
FDGLYRAIDIYLESHPKLSSEDRTKLCRCLNYKKLTLETCKQLAQNPKIPPNIAVQALKSQQLSNETQPHSREDKKRVNK
IWNSRKYLEEKPILVHLKGFGMSEKFEDDLKMNLERKQWNSSGKNCKEKKSEVVSSSSFPRLC*

DNA
ATGTCTCTTCTCTGTGATCTTCAAATCAATCTCAATAACCAATTCACTTTCTTCGTCAATCAGGATTTGATTTCAGAGTA
CTCAGGGTTCTTGAGGAAGATGATAAAACAGAGCAATAAGAAGAAGAAGAATCACAAGAACAGTAGAATCATTATCGAAG
TCGAAGATTTTCCAGGTGGGTCAGATGGGTTCGACTTGGTTTCAAGATTCTGTTACGGTAATGGCGGAGGAATCTCGATC
GATGTCTCAAATGTCTCCATTTTGCATTGTTCTTCTGTCTTCCTTGAGATGACAGAGAAACTCTGTTCCTCGAATCTTTT
GCTTCAAACAGACAAGTTTTTAGAAGGTATGTTCTACTGGTCATGGAATGACATCGTTTTGTGTCTCAAGAGCTGCGAAC
AAGTGTTCCTACACGCAGATTCTTACGGTCTTGTTGATAAGCTTGTTTTCGGGGTTTTAGCCAAAATCGCTCAGAATTCA
GACATGAGTCATGTCTTTTCATCATCCTCTCCGTCTTCCTCTGCCTCTGCCTCCTCTCATTCGCCGGAGACGGCAAGGAA
TAGGTCTGATTCTGACAAACGGTCTACTTCAAGGTCGCTTTCTTGCAGGACAAGTAACGAGTGGTGGTTCGATGATATGT
CAATTCTCGGGCCAAAAATCATCGAAAAGGTGATGAAAACACTTGGTGCGCATGATAAGAACAATGACAGCTTGGTCCTC
ACAAGATTTCTCCTCCATTACCTCAAGACAAAGGTCCAAAACAAATCAAACAACAAGCTCGAGTATGCAGGTTTAGCTGA
TACAGCGGTTCGAGGAGTGGTTTTCGCGGCGAAAACCGCTTTTTCCTGCAGAAAAATGTTCTGGGTTCTTCGCGTTTTAT
CGGGATTTAGCATCAGTAAAGAATCAAGAATTGGTTTAGAGAGAGTTATAGGAGAAATGCTGGATCAAGCAACACTTGAT
GATCTTCTGATTCCAGCAGGAGGAAAAAAAGAAAAAGGGTTTTACGATGTGGATTTGGTGATAAGATTACTCAAAGTGTT
CGTGAGAACTGGAAACACAGAAGAAGAACAGAATTTGAAAATGAGAAGAATTGGGAAGTTGATTGATAAGTATCTGAGAG
AGATATCTCCAGACCAGAATCTTAAAGAGTCAAAGTTTCTTGAAGTTGCAGAGAGTTTGCCAGATTCAGCTAGAGATTGG
TTTGATGGATTATACAGAGCCATTGATATCTATCTTGAGTCTCATCCGAAACTATCATCCGAGGATAGAACAAAACTATG
TCGATGTCTAAACTACAAGAAATTGACATTGGAAACATGCAAACAACTTGCGCAAAATCCCAAGATCCCTCCTAATATTG
CAGTTCAAGCACTCAAGTCACAACAATTGTCAAACGAGACTCAACCACACTCAAGAGAGGACAAGAAGAGAGTAAACAAG
ATCTGGAATTCGCGTAAGTACTTAGAAGAGAAACCAATACTGGTGCATTTGAAAGGTTTTGGGATGTCGGAGAAGTTTGA
AGATGACCTAAAGATGAATTTGGAGAGGAAGCAATGGAATAGTTCTGGAAAAAATTGTAAGGAAAAGAAGAGTGAAGTAG
TGTCAAGTTCTAGTTTTCCAAGGCTTTGTTAA