Details for Lyrate rockcress Locus 16048350

Position : sca2 ( 5`- 16600634 .. 16597478 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_895389 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048350

Protein [Map View]
MSFRDDNEEGRNDLRRPFIHTGSWYRMGSRQSSMMGSSQVIRDSSISVLACVLIVALGPIQFGFTCGYSSPTQAAITKDL
GLTVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVP
VYIAEIAPQNMRGGLGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGILPCTVLIPGLFFIPESPRWLAKMGMTDDFETSL
QVLRGFETDITVEVNEIKRSVASSTKRNTVRFEDLKRRRYYFPLTVGIGLLVLQQLGGINGVLFYSSTIFESAGVTSSNA
ATFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISLVIVAAAFYLKGFVSPDSDMYNWLSILSVVGVVAMVVSFSL
GMGPIPWLIMSEILPVNIKGLAGSIATLANWFFSWLITMTANLLLAWSSGGTFTLYGLVCAFTVVFVTLWVPETKGRTLE
ELQALFR*

DNA
ATGAGTTTCAGAGATGATAATGAGGAGGGTAGGAATGATTTGCGACGGCCGTTTATACACACCGGAAGCTGGTACCGGAT
GGGTTCGAGACAATCGAGTATGATGGGCTCGTCTCAAGTTATTCGAGACAGCTCTATCTCTGTTCTTGCATGTGTTTTGA
TCGTTGCTCTTGGTCCTATTCAATTCGGATTCACTTGTGGTTATTCATCTCCAACTCAAGCTGCAATCACTAAGGATCTC
GGTTTAACGGTATCTGAGTACTCTGTGTTTGGTTCTCTGTCCAATGTGGGTGCTATGGTTGGTGCAATTGCCAGTGGTCA
GATTGCAGAATACATTGGACGAAAAGGGTCTCTGATGATTGCTGCAATTCCCAATATCATTGGATGGCTTTGCATATCAT
TTGCAAAAGATACTTCTTTTCTTTATATGGGAAGACTTCTAGAAGGCTTTGGCGTTGGGATCATCTCTTACACTGTACCT
GTATATATCGCTGAGATAGCTCCACAAAATATGAGAGGAGGATTGGGTTCGGTTAACCAGCTTTCTGTGACAATTGGAAT
AATGTTGGCGTATCTACTTGGCCTCTTTGTTCCATGGAGAATTCTTGCAGTTCTGGGGATATTGCCGTGCACAGTATTGA
TACCAGGTCTATTTTTCATCCCCGAATCCCCTCGCTGGCTGGCAAAAATGGGTATGACAGATGACTTTGAAACTTCATTA
CAAGTTCTTCGAGGATTCGAGACTGATATTACAGTTGAAGTTAATGAAATCAAGAGATCTGTGGCATCATCTACAAAGCG
AAATACAGTTCGGTTTGAAGATCTCAAACGCAGGAGATACTATTTCCCACTTACGGTTGGTATAGGGTTGCTTGTACTTC
AACAACTCGGTGGAATTAATGGCGTCCTATTCTATTCCAGTACAATATTTGAATCTGCAGGAGTTACATCGAGTAACGCA
GCAACATTTGGGGTCGGGGCTATTCAGGTAGTCGCTACTGCAATATCGACATGGTTGGTGGACAAAGCAGGTCGTCGACT
TCTGCTTACCATCTCTTCGGTTGGGATGACAATTAGCCTTGTAATTGTCGCAGCTGCTTTCTACCTTAAGGGATTTGTGT
CTCCTGATTCAGACATGTACAATTGGCTGAGCATATTGTCAGTAGTTGGAGTTGTGGCAATGGTTGTTTCTTTCTCATTG
GGAATGGGACCAATACCGTGGCTCATTATGTCTGAGATCCTTCCTGTGAACATAAAGGGTTTAGCTGGAAGTATTGCAAC
CCTAGCCAATTGGTTCTTTTCTTGGTTGATCACTATGACAGCAAACTTGCTCTTAGCCTGGAGCAGTGGAGGAACTTTCA
CTCTGTACGGGTTGGTTTGTGCATTCACAGTGGTGTTCGTGACTCTATGGGTTCCTGAGACCAAAGGCAGAACTCTTGAA
GAACTTCAAGCCTTGTTCAGATGA