Details for Lyrate rockcress Locus 16048349

Position : sca3 ( 5`- 8034489 .. 8033230 -3` )
Annotation : [B2G] u-box domain-containing protein
External links : CoGe
PGDD synteny : 16048349

Protein [Map View]
MGRDETETYITVPSFFKCPISLDVMRSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQLLKTKDFVPNLTLQRLIKIWSD
SIGRYNTAGSPPPSGREVPTVEEVNVLLKRLMSLEKNDETRIEILSRIVRFVKDSDSNREFLSAMKEFVPMLVDIIRTKT
KKIELVLMAIRILDTVKGDRERLSNLMLANDDGDCLTAILLAIQRGNLESKIESVRVLDWISFDAKSKLLIAERDGIITE
MIKSISITESDPSLIEASLSFLITISKSKRVRSKLIAAKTITKIKDILMTETLTNVAVTEKSLKLLETLSSKREGRLEIC
GEDNGRCVEGVVKKLLKVSTTATEHAVTILWCLCYVFREDKTAEETVERSNGVTKLLVVIQSNCSAMVRQMAKDLIKVLK
INSSALSAYETKTTHIMPF*

DNA
ATGGGGAGAGATGAAACTGAGACGTACATTACAGTGCCAAGTTTCTTCAAATGTCCTATATCTCTAGACGTTATGAGATC
TCCGGTTAGTCTCTGCACCGGCGTTACTTATGATCGAGCCAGTATTCAGAGATGGCTCGATGGTGGTAACAACACTTGTC
CCGCTACTATGCAACTTCTCAAAACTAAGGATTTTGTTCCTAACCTCACTCTTCAACGCCTTATCAAAATCTGGTCTGAT
TCCATCGGCCGTTACAACACCGCTGGTTCTCCGCCACCGTCTGGTAGAGAAGTTCCGACGGTTGAAGAAGTGAATGTGTT
GCTGAAGAGATTGATGAGTCTGGAGAAAAACGATGAGACTCGGATTGAGATATTGTCCAGGATCGTTCGATTCGTGAAGG
ATTCGGATTCGAACAGAGAGTTTCTCTCGGCGATGAAGGAGTTCGTACCAATGCTCGTTGATATTATACGCACGAAGACG
AAGAAGATCGAGTTAGTTCTAATGGCGATTAGGATTTTGGATACGGTTAAAGGAGATCGTGAACGGTTATCGAATCTGAT
GTTGGCGAATGACGACGGAGATTGTTTAACGGCGATTCTCTTAGCGATTCAACGCGGGAATCTGGAATCGAAGATTGAAT
CCGTTAGGGTTTTGGATTGGATCTCATTCGACGCTAAATCGAAGCTCTTAATCGCAGAACGCGACGGGATTATAACAGAG
ATGATCAAATCAATCAGTATCACTGAGTCAGATCCGAGTTTGATCGAAGCGAGTTTATCGTTTCTAATCACAATCTCGAA
ATCGAAACGAGTGAGATCGAAACTAATCGCTGCGAAAACAATCACGAAGATCAAAGACATTCTTATGACGGAGACGTTAA
CAAACGTCGCCGTCACGGAGAAGTCTCTGAAGCTGTTAGAGACTCTGTCGTCGAAACGAGAAGGAAGATTGGAGATTTGT
GGAGAAGATAATGGAAGATGTGTGGAAGGAGTGGTGAAGAAGTTGTTGAAAGTATCTACGACGGCGACGGAACATGCCGT
GACGATTCTGTGGTGTTTGTGTTATGTATTCAGGGAAGATAAGACGGCGGAGGAGACGGTGGAGAGAAGTAACGGAGTGA
CGAAGCTTTTAGTGGTGATACAGAGCAACTGCTCGGCGATGGTGAGACAAATGGCGAAAGATTTGATTAAAGTGTTGAAG
ATTAATTCATCTGCTTTGTCTGCTTACGAGACCAAGACTACTCATATTATGCCTTTTTGA