Details for Lyrate rockcress Locus 16048338

Position : sca3 ( 5`- 7120102 .. 7127993 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897998 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048338

Protein [Map View]
MASEQLMSPASGGGGRYFQMQPEQFPSMVSSLFSFAPAPTQESNRIFEELPKAVIVSVSRPDAGDISPVLLSYTIECQYK
QFKWQLVKKASQVFYLHFALKKRAFIEEIHEKQEQVKEWLQNLGIGDHAPVVQDEDADEVPLHQDESAKNRDVPSSAALP
VIRPLGRQQSISVRGKHAMQEYLNHFLGNLDIVNSREVCRFLEVSMLSFSPEYGPKLKEDYIMVKHLPKFSKSDDDSNRC
CGCCWFCCCNDNWQKVWGVLKPGFLALLEDPFDAKLLDIIVFDVLPVSNGNDGVDVSLAVELKDHNPLRHAFKVTSGNRS
IRIRAKSSAKVKDWVASINDAALRPPEGWCHPHRFGSYAPPRGLTDDGSQAQWFVDGGAAFAAIAAAIENAKSEIFICGW
WVCPELYLRRPFDPHTSSRLDNLLENKAKQGVQIYILLYKEVALALKINSVYSKRRLLGIHENVRVLRYPDHFSSGVYLW
SHHEKLVIVDNQVCFIGGLDLCFGRYDTFEHKVGDNPSVTWPGKDYYNPRESEPNTWEDALKDELNRKKHPRMPWHDVHC
ALWGPPCRDVARHFVQRWNYAKRNKAPYEDSIPLLMPQHHMVIPHYMGRQEESDTESKKDEDSIKGIRRDDSFSSRSSLQ
DIPLLLPQEPVDQDGSSRGHKENGTNNRNGPFSFRKLKIEPVDGDTPMRGFVDDRNGLDLPVAKRGSNAIDSEWWETQEH
DYQVGSPDETGQVGPRTSCRCQIIRSVSQWSAGTSQVEESIHSAYRSLIDKAEHFIYIENQFFISGLSGDDTIKNRILEA
LYKRILRAHNEKKSFRVVVVIPLLPGFQGGIDDSGAASVRAIMHWQYRTIYRGHNSILTNLYNTIGAKAHDYISFYGLRA
YGKLSEDGPVATSQVYVHSKIMIIDDRAALIGSANINDRSLLGSRDSEIGVLIEDTEFVDSRMAGKPWKAGKFSSSLRLS
LWSEHLGLRTGEIDQIIDPVSDSTYKEIWMATAKTNTMIYQDVFSCVPNDLIHSRMAFRQSLSYWKEKLGHTTIDLGIAP
EKLESYHNGDIKRSDPMDRLKSIKGHLVSFPLDFMCKEDLRPVFNESEYYASPQVFH*

DNA
ATGGCATCTGAGCAGTTGATGTCTCCCGCCAGTGGTGGTGGAGGACGCTACTTTCAGATGCAGCCTGAGCAGTTTCCTTC
CATGGTCTCTTCGTTGTTTTCGTTTGCGCCGGCTCCTACGCAGGAGTCTAATCGCATATTTGAAGAATTACCAAAAGCAG
TTATCGTCTCTGTCTCTCGGCCTGATGCTGGCGATATTAGCCCTGTACTCTTGTCTTACACCATTGAGTGCCAATACAAG
CAGTTCAAGTGGCAACTTGTGAAGAAAGCATCTCAAGTATTTTATTTGCATTTTGCATTGAAGAAACGTGCTTTTATTGA
AGAAATTCACGAGAAGCAGGAACAGGTTAAAGAATGGCTTCAAAATCTAGGAATAGGGGATCATGCACCCGTTGTGCAAG
ATGAAGATGCTGATGAAGTTCCTCTACATCAAGATGAGAGTGCCAAAAATAGAGATGTTCCCTCAAGCGCTGCTTTGCCA
GTCATTCGTCCTTTGGGAAGACAGCAGTCCATATCAGTCAGAGGAAAGCATGCAATGCAAGAATATCTGAATCATTTCCT
AGGGAATCTTGATATTGTCAATTCACGGGAGGTGTGCAGGTTTTTGGAGGTCTCGATGTTGTCATTCTCACCAGAGTATG
GGCCCAAATTGAAAGAAGACTATATTATGGTAAAACATCTACCGAAATTTTCAAAGAGTGATGATGATTCTAATAGATGC
TGTGGATGCTGTTGGTTCTGTTGCTGCAACGATAATTGGCAAAAGGTGTGGGGGGTACTAAAGCCAGGTTTTCTCGCGTT
ACTGGAAGATCCATTTGATGCGAAGCTATTAGATATAATTGTTTTTGATGTCCTGCCAGTTTCTAATGGAAATGATGGTG
TGGATGTATCACTAGCAGTAGAACTGAAGGATCATAATCCTTTGCGGCATGCATTCAAGGTAACATCTGGGAACAGGAGT
ATAAGAATAAGGGCAAAGAGTAGTGCAAAAGTTAAAGATTGGGTGGCTTCTATTAACGATGCTGCTCTTAGACCTCCTGA
GGGTTGGTGTCATCCCCATCGCTTTGGCTCATATGCTCCACCGAGGGGTTTGACAGATGACGGAAGTCAAGCCCAGTGGT
TTGTAGATGGTGGGGCAGCTTTTGCAGCCATTGCTGCAGCGATTGAAAATGCTAAATCTGAGATTTTCATCTGTGGCTGG
TGGGTGTGCCCAGAACTCTATCTTAGGCGCCCTTTTGACCCGCATACTTCATCCAGACTTGATAATTTGTTGGAGAATAA
AGCTAAGCAAGGAGTTCAGATATACATCCTTCTCTACAAGGAGGTTGCTCTTGCTTTAAAGATCAACAGTGTATATAGCA
AACGCAGGCTTCTTGGCATTCATGAGAATGTGCGGGTACTTCGTTATCCTGATCATTTCTCAAGTGGTGTCTACCTCTGG
TCTCACCATGAAAAACTCGTCATCGTCGATAATCAGGTTTGCTTTATTGGAGGGCTAGACTTGTGTTTTGGCCGGTATGA
CACGTTTGAACATAAAGTTGGAGATAACCCTTCTGTGACATGGCCTGGAAAGGACTATTACAACCCCAGAGAGTCTGAAC
CCAATACTTGGGAGGATGCTCTGAAAGATGAATTAAACCGTAAAAAGCATCCACGGATGCCTTGGCATGATGTGCATTGT
GCTTTATGGGGACCACCTTGCCGTGACGTGGCTAGGCACTTTGTTCAACGCTGGAACTATGCTAAGAGAAACAAAGCACC
ATATGAGGATTCAATTCCGCTTCTTATGCCTCAGCATCACATGGTAATACCCCACTACATGGGAAGGCAAGAGGAGTCAG
ACACTGAATCCAAGAAAGACGAAGATAGCATTAAAGGGATTAGAAGAGATGATTCATTTTCTTCTAGATCATCTTTGCAG
GACATTCCATTACTTTTGCCTCAAGAACCCGTTGATCAGGATGGTTCGAGTAGGGGGCATAAAGAAAATGGAACAAACAA
TAGAAATGGTCCTTTCTCTTTCCGGAAATTGAAAATTGAACCAGTTGATGGAGATACTCCTATGAGGGGCTTTGTAGATG
ATCGTAATGGGCTAGATCTTCCAGTAGCAAAGCGTGGTTCTAATGCAATAGATTCAGAGTGGTGGGAAACACAAGAACAT
GATTATCAGGTTGGGTCGCCAGATGAGACAGGGCAAGTCGGTCCGAGAACTTCATGCCGCTGTCAGATTATACGAAGTGT
CAGTCAGTGGTCTGCCGGTACAAGCCAAGTTGAAGAGAGTATCCATTCTGCTTACCGTTCTCTCATTGACAAAGCTGAAC
ATTTTATCTACATCGAGAATCAGTTTTTCATATCAGGCCTTTCTGGAGATGACACAATAAAGAACCGTATCTTAGAAGCA
TTGTACAAGAGGATTTTGCGTGCCCATAATGAGAAGAAAAGTTTCAGGGTTGTTGTTGTTATACCTCTCCTCCCAGGTTT
CCAGGGAGGTATTGACGACAGTGGTGCAGCATCTGTTAGAGCCATAATGCATTGGCAGTATCGAACCATATACAGAGGAC
ATAACTCAATATTGACTAATCTTTACAATACTATTGGCGCAAAGGCTCATGATTATATTTCCTTCTATGGCCTTAGGGCA
TATGGTAAACTTTCTGAGGATGGACCTGTAGCCACTAGTCAGGTGTATGTTCACAGTAAAATCATGATAATTGATGACCG
TGCCGCGTTGATTGGATCTGCCAATATCAACGACCGGAGTTTACTTGGCTCAAGGGATTCTGAGATTGGAGTACTAATCG
AAGACACAGAGTTCGTAGATTCTCGCATGGCAGGAAAACCATGGAAGGCTGGAAAATTTTCTTCAAGTCTTAGGCTCTCT
TTGTGGTCCGAACACCTTGGACTTCGTACTGGAGAGATCGACCAGATTATTGATCCAGTCTCTGATTCAACCTACAAGGA
GATATGGATGGCAACCGCAAAGACAAACACAATGATATACCAGGATGTCTTCTCTTGTGTGCCCAATGATCTCATCCATT
CAAGAATGGCCTTCAGACAAAGCCTATCGTATTGGAAAGAGAAACTGGGGCACACAACGATCGATTTGGGGATAGCACCC
GAGAAGCTGGAGTCTTACCACAATGGAGACATCAAGAGAAGCGATCCAATGGACAGACTAAAGTCGATAAAGGGACATCT
CGTCTCTTTCCCTTTAGATTTCATGTGTAAAGAAGATCTAAGACCGGTTTTCAATGAGAGTGAATACTACGCCTCCCCTC
AAGTCTTCCATTGA