Details for Lyrate rockcress Locus 16048201

Position : sca2 ( 5`- 16454980 .. 16453254 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048201

Protein [Map View]
MFIQLLCFFLFLLLLLQATMSKRSFKKFVEQELGSRPHFLIYTVLEWSLIVILFIDGIIAFLSNQYAKFFDLNIPCLLCT
RIDHILVPRDPRFYYNESICDSHKKKVSSLAYCHVHKKLSEIKHMCEGCLLSFATEKESDCDTYKSLIGILHKDLELLID
DERELPLAFKKDDNFIQTTKNLVDHKNNIKNDSLKQHCSCCGELLKIKSEKLPNNNNSFLAPAPSPRVSNNKLSERESEF
KDLDVDRTPSFVRGGNKFFGIPLSDSVQNSPRWSVRSLKKSLLDKTENASDTADPNGESILNQLKKEVRLDKKSLIDLYM
ELDEERSASAVAANEAMAMITRLQAEKAAVQMEALQYQRMMDEQAEYDQEALQSMSTELAKREEEMKELEAEFEAYREKY
GSLTDEEDAREEFHEQNGNASANDDCQETKPVSDLGVCSSNQEENGENIDRNGSTQSKRSEESTAEKDVSADEEKGTESK
EGIVKELSDITERLSALQSNGDLLKHIADVLDVSEGEAILLQISQNLHMLRSFVAMPSESMNL*

DNA
ATGTTTATACAATTGCTCTGTTTTTTCTTGTTCTTGTTACTGCTTTTACAAGCCACAATGTCTAAACGTTCTTTCAAGAA
ATTTGTGGAACAAGAACTCGGATCTCGTCCTCATTTCCTCATCTACACGGTTCTTGAATGGAGCCTCATCGTTATCCTCT
TCATCGACGGCATAATCGCCTTTCTATCAAACCAATATGCCAAATTCTTCGACCTCAACATTCCTTGTCTTCTCTGCACC
AGAATCGACCACATTCTCGTCCCTAGAGACCCTCGATTCTATTACAATGAGTCAATCTGCGACTCTCACAAGAAGAAAGT
ATCTTCTCTTGCTTATTGCCATGTCCATAAGAAGCTATCTGAGATCAAACATATGTGTGAAGGATGTCTTCTCTCTTTCG
CCACCGAGAAAGAATCTGACTGTGATACTTATAAGTCTCTCATTGGCATCTTACACAAAGATCTCGAGCTTCTCATTGAC
GATGAACGAGAACTTCCCTTGGCATTCAAGAAAGACGACAATTTTATTCAGACAACAAAAAATCTGGTGGATCACAAGAA
CAACATTAAAAATGATAGCTTGAAGCAACATTGTTCGTGTTGCGGAGAATTATTGAAGATAAAATCTGAGAAGTTGCCGA
ATAACAACAATTCTTTCCTTGCTCCTGCTCCTTCTCCTAGGGTTTCGAACAACAAACTGTCTGAAAGAGAATCTGAGTTT
AAGGATCTAGATGTGGACAGAACACCGAGCTTTGTTAGAGGAGGTAACAAGTTTTTTGGGATCCCTCTGTCTGATTCGGT
GCAAAATAGTCCACGATGGTCCGTTCGATCTCTTAAGAAATCTCTTTTGGATAAGACAGAGAATGCTTCGGACACGGCAG
ATCCAAACGGTGAATCCATCCTTAATCAGCTCAAGAAAGAGGTTCGCTTGGACAAGAAGTCACTCATTGATTTGTATATG
GAGTTAGATGAAGAGAGAAGTGCTTCAGCTGTTGCAGCCAACGAAGCGATGGCTATGATCACGAGGCTTCAAGCCGAGAA
AGCTGCTGTTCAAATGGAGGCTTTGCAGTACCAAAGAATGATGGATGAACAAGCAGAGTATGACCAAGAAGCTTTGCAGT
CGATGAGTACCGAATTGGCGAAGAGGGAGGAGGAAATGAAGGAGCTTGAAGCTGAGTTTGAGGCTTACAGAGAGAAATAT
GGAAGTTTGACAGATGAAGAAGATGCAAGAGAAGAGTTTCATGAACAAAACGGCAATGCTAGTGCAAATGATGATTGCCA
AGAAACCAAACCAGTCTCGGATTTAGGCGTCTGTTCTTCTAATCAGGAGGAGAATGGCGAAAACATCGATCGAAATGGGT
CTACTCAATCTAAAAGGTCAGAGGAGTCTACCGCGGAAAAGGATGTCTCTGCAGATGAAGAAAAAGGGACAGAGAGCAAA
GAAGGGATAGTAAAAGAGCTTTCAGATATCACAGAGAGACTAAGTGCTCTTCAATCAAATGGTGATCTGTTGAAACATAT
TGCTGATGTTTTGGATGTTAGTGAAGGAGAAGCAATTCTACTGCAGATCTCTCAGAATTTGCACATGCTTCGTAGTTTTG
TTGCTATGCCTTCAGAATCCATGAACTTGTAA