Details for Lyrate rockcress Locus 16048096

Position : sca3 ( 5`- 4471970 .. 4462847 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478454 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048096

Protein [Map View]
MAAANAPIIMKEVLTLPSVGIGQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL
ALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVAFWKWITPKMLGLVTQTSVYHWSIEGDSEPVKMFDRTANLANNQII
NYKCSPNEKWLVLIGIAPGSPERPQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDLETASAIYRNRISPDPIFLTS
EASSLGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES
PQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNTYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYMFLLQTILRTDPQGAVNFALMMSQMEGGCPVDY
NTITDLFLQRNLIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAILANGMFSHYDRPRVAQLCEKAGLYIQS
LKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFGFVPD
LTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLV
SEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWEKVLTEENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQN
LLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVDAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDA
VWSQVAKAQLRDGLVSDAIESFIRADDATQFLEVIRASEDTNVYDDLVRYLLMVRQKVKEPKVDSELIYAYAKIERLGEI
EEFILMPNVANLQNVGDRLYDEALYEAAKIIYAFISNWAKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEF
RLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIP
KLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVL
ALRLDHTRVVDIMRKAGHLRLIKPYMVAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVE
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELA
WINNMIDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLALPAPPMPGMGGGGYGPPP
PMGGMPGMPPMPPYGMPPMGGY*

DNA
ATGGCGGCGGCTAACGCGCCAATCATCATGAAGGAGGTCCTAACGCTTCCGAGCGTTGGGATCGGTCAACAGTTCATCAC
CTTTACAAATGTCACTATGGAGTCTGATAAGTACATATGTGTACGAGAGACGGCACCACAGAACAGTGTTGTAATTATCG
ATATGAATATGCCCATGCAGCCTTTAAGGAGACCTATAACTGCTGATTCTGCTCTTATGAACCCAAACTCGAGGATCCTT
GCCTTAAAAGCTCAAGTTCCAGGAACTACTCAGGATCATCTACAGATATTTAACATCGAAGCAAAAGCAAAGTTGAAGTC
ACATCAGATGCCTGAGCAGGTTGCTTTTTGGAAGTGGATCACACCAAAGATGCTGGGGCTGGTCACGCAAACTTCTGTGT
ATCATTGGTCGATTGAAGGTGATTCTGAGCCAGTTAAGATGTTTGATCGAACGGCCAATTTGGCAAACAATCAAATTATA
AACTATAAGTGCTCTCCTAATGAGAAGTGGTTGGTCTTGATTGGAATTGCTCCTGGCTCTCCTGAGAGACCACAATTGGT
AAAAGGAAATATGCAGCTTTTCTCGGTGGATCAACAGCGGAGCCAGGCCCTTGAAGCACATGCTGCATCATTTGCTCAGT
TTAAGGTCCCTGGGAATGAGAATCCTTCTATTCTTATATCCTTTGCAAGCAAGAGCTTTAATGCTGGGCAGATAACATCA
AAGTTGCATGTTATTGAACTTGGTGCCCAACCAGGAAAACCATCATTTACAAAAAAGCAGGCAGATCTCTTTTTCCCCCC
AGATTTTGCTGATGATTTTCCTGTGGCCATGCAGGTCTCTCACAAGTTTAACTTGATTTATGTCATCACCAAGCTTGGCC
TGCTGTTTGTATATGATCTAGAGACAGCTTCTGCTATCTACAGAAATCGGATAAGTCCGGACCCAATTTTCTTAACGTCT
GAAGCTTCCTCACTTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTTTTGGCAACCGTAAATGAGGCCACCAT
AATACCTTTTATTAGTGGTCAATTGAACAATTTGGAACTTGCTGTCAATCTTGCTAAAAGAGGAAACCTCCCTGGTGCAG
AGAATCTGGTAGTCCAGCGGTTCCAAGAGTTATTTGCTCAAACAAAGTACAAGGAGGCTGCTGAGCTTGCTGCTGAATCT
CCTCAGGGTATTCTACGGACACCTGATACAGTGGCCAAATTCCAGAGTGTTCCTGTACAAGCAGGGCAAACTCCTCCATT
GTTACAGTATTTTGGGACCCTTTTGACTAGAGGGAAGCTCAATACATATGAGTCTTTGGAACTATCTCGGCTTGTTGTGA
ATCAAAACAAGAAGAACCTCTTGGAAAACTGGTTAGCCGAGGATAAGTTAGAATGCAGTGAAGAACTCGGAGACCTTGTC
AAGACTGTGGATAATGACCTTGCTCTAAAAATTTACATCAAAGCTAGAGCTACTCCAAAAGTCGTTGCAGCTTTTGCAGA
GCGAAGGGAGTTTGACAAAATACTGATTTATTCAAAGCAGGTTGGGTACACACCTGATTACATGTTTCTTCTGCAAACGA
TACTTCGTACGGATCCTCAGGGAGCAGTAAATTTTGCTTTAATGATGTCCCAAATGGAAGGAGGTTGTCCAGTTGACTAC
AACACTATCACTGATCTTTTCCTTCAGAGAAATCTGATCCGTGAAGCCACTGCTTTCCTTCTGGATGTTCTGAAGCCAAA
CTTACCCGAGCATGCTTTTCTACAAACTAAGGTTTTGGAGATCAATTTGGTAACCTTTCCTAATGTGGCTGATGCAATCT
TAGCAAATGGGATGTTCAGCCATTATGACAGGCCTCGTGTTGCTCAGCTTTGTGAAAAGGCTGGACTTTACATCCAATCC
TTAAAGCATTACTCGGAGTTACCTGATATCAAACGTGTAATTGTTAACACACATGCTATTGAGCCACAGGCTCTTGTTGA
GTTTTTCGGTACTCTTTCTAGCGAGTGGGCTATGGAGTGCATGAAAGATCTCTTGTTGGTCAACCTGAGAGGCAACCTTC
AGATAATCGTTCAGGCTTGCAAGGAGTACTGTGAGCAACTTGGTGTCGATGCATGCATTAAACTCTTTGAGCAATTCAAG
TCATACGAAGGGCTGTACTTTTTCCTAGGTTCATACTTGAGTATGAGTGAGGATCCTGAGATTCACTTCAAGTACATCGA
AGCAGCTGCCAAGACTGGTCAAATAAAGGAGGTTGAGCGTGTGACTAGAGAGTCTAACTTTTATGATGCTGAAAAGACGA
AGAACTTTTTGATGGAAGCTAAGCTTCCTGATGCCCGACCTTTGATAAATGTCTGCGATCGTTTTGGCTTTGTGCCTGAT
CTTACTCATTACCTCTACACAAACAACATGCTGCGTTACATTGAAGGTTACGTTCAGAAGGTAAATCCTGGGAATGCTCC
CTTAGTTGTGGGGCAGTTGCTTGATGACGAATGCCCTGAAGATTTTATAAAAGGCCTCATTCTTTCTGTTCGTTCATTAC
TTCCTGTTGAACCCCTTGTTGATGAATGTGAAAAGAGAAATCGACTCCGTCTCCTTACTCAGTTCTTGGAGCATCTAGTT
AGTGAGGGAAGCCAAGATGTGCATGTCCATAATGCCTTGGGTAAAATTATCATAGACAGTAACAACAACCCCGAGCATTT
CCTGACCACCAATCCTTACTACGACTCTAAGGTTGTGGGTAAGTACTGCGAGAAACGTGATCCCACTCTGGCCGTGGTTG
CATACAGAAGAGGACAATGTGACGAGGAACTCATCAATGTCACCAACAAGAACTCTTTGTTCAAGTTACAAGCCAGGTAC
GTAGTGGAGAGGATGGATGGTGACCTCTGGGAGAAGGTTCTTACGGAAGAAAATGAATATAGGAGGCAACTTATCGACCA
AGTTGTGTCTACTGCTTTACCTGAAAGCAAGAGCCCAGAGCAAGTTTCTGCAGCTGTTAAAGCATTCATGACTGCTGATC
TGCCTCATGAGCTTATTGAGCTTCTTGAAAAAATTGTGCTTCAAAATTCTGCCTTCAGTGGAAATTTCAATCTGCAAAAT
CTGCTTATACTGACAGCTATTAAGGCAGATCCGTCTAGAGTTATGGATTACATTAACAGGCTGGATAATTTTGATGGTCC
AGCTGTTGGAGAAGTGGCGGTTGACGCTCAATTGTATGAGGAAGCATTTGCGATTTTTAAGAAGTTCAACTTAAATGTTC
AGGCTGTCAACGTATTGTTGGATAACGTCAGAAGCATTGAGCGTGCTGTTGAGTTTGCTTTCCGGGTTGAAGAAGATGCT
GTTTGGAGTCAAGTCGCTAAGGCTCAGCTCAGGGACGGATTAGTCAGTGATGCTATTGAGTCCTTTATCCGAGCTGATGA
TGCCACTCAGTTCCTGGAGGTCATCCGCGCCTCTGAAGATACTAATGTCTATGATGACTTGGTGAGATACCTTCTGATGG
TTAGACAGAAGGTGAAGGAACCCAAGGTGGATAGTGAGCTCATCTATGCTTATGCAAAGATTGAAAGGTTGGGTGAGATT
GAAGAATTTATTCTGATGCCCAACGTTGCCAACCTTCAAAATGTTGGTGACCGCTTGTATGATGAAGCTCTGTATGAGGC
TGCAAAGATAATATATGCATTCATATCGAATTGGGCCAAGTTAGCCGTCACCCTTGTGAAGTTGCAACAGTTCCAAGGTG
CTGTTGATGCTGCAAGGAAAGCAAACAGTGCAAAGACATGGAAGGAAGTCTGCTTTGCTTGTGTTGATGCTGAGGAATTC
CGACTGGCCCAAATCTGTGGACTTAACATTATCATACAGGTGGATGACCTGGAAGAAGTAAGCGAGTACTACCAGAACAG
AGGATGCTTCAATGAATTGATCTCACTTATGGAGAGTGGACTTGGTCTGGAACGTGCTCACATGGGGATCTTCACCGAGT
TGGGTGTCCTGTACGCCAGATATCGTTATGAGAAGCTTATGGAACACATCAAGTTGTTCTCGACTCGCCTCAATATTCCC
AAACTTATCCGGGCCTGTGATGAACAACAGCATTGGCAGGAACTTACCTATCTTTACATTCAATATGATGAGTTTGATAA
TGCTGCAACCACTGTCATGAATCATTCTCCTGAAGCATGGGAGCACATGCAATTCAAAGACATTGTTGCCAAGGTTGCGA
ATGTTGAGCTTTACTATAAGGCCGTTCACTTCTACTTGCAAGAGCACCCTGATATAATCAACGATCTTCTCAATGTGCTT
GCTCTGCGGTTAGATCACACTCGTGTCGTTGATATTATGCGCAAGGCTGGTCACTTGCGTCTTATCAAGCCATACATGGT
TGCAGTTCAGAGCAATAATGTCTCTGCTGTAAATGAAGCTCTGAATGAGATATATGTAGAAGAAGAAGACTATGACAGGT
TGCGCGAGTCTATTGATTTGCATGACAGTTTTGACCAGATAGGTCTCGCCCAGAAGATTGAGAAACACGAGCTTGTCGAA
ATGAGACGTGTGGCTGCTTATATCTACAAGAAAGCTGGTAGATGGAAGCAATCGATTGCTTTATCAAAGAAAGATAACAT
GTACAAGGACTGTATGGAAACTGCTTCGCAATCCGGCGACCATGATCTTGCAGAACAACTTCTCGTCTACTTCATTGAAC
AGGGGAAAAAGGAATGCTTTGCTACATGTCTCTTTGTCTGTTATGACTTAATCCGACCAGACGTTGCTCTAGAACTTGCT
TGGATCAACAATATGATAGACTTTGCCTTCCCGTATCTCCTCCAGTTTATCCGAGAATACTCTGGCAAAGTGGATGAGCT
AATCAAGGACAAGCTGGAGGCACAAAAAGAGGTGAAGGCCAAAGAACAGGAAGAGAAGGATGTCATGTCCCAACAGAACA
TGTACGCCCAATTATTGCCATTGGCTCTACCTGCCCCTCCGATGCCAGGAATGGGAGGTGGTGGGTATGGTCCGCCACCA
CCAATGGGCGGAATGCCAGGAATGCCTCCAATGCCACCGTATGGAATGCCTCCAATGGGCGGCTACTAA