Details for Lyrate rockcress Locus 16048092

Position : sca3 ( 5`- 1849076 .. 1846608 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048092

Protein [Map View]
MVLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAVAKLLEGAPSKGLRKFLKAN
CQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQFTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTM
IIQAIGLLDDLDKELNTYAMRVREWYGWHFPELAKIISDNILYAKSVKLMGNRVNAAKLDFSEILADEIEADLKDAAVIS
MGTEVSDLDLLHIRELCDQVLSLSEYRAQLYDYLKSRMNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTIQILGA
EKALFRALKTKHATPKYGLIYHASVVGQAAPKHKGKISRSLAAKAVLAIRVDALGDGQDSTMGLENRAKLEARLRNLEGK
DLGRLSGSAKGKPKIEVYNKDKKMGSGGLITPAKTYNTAADSLLGESSAKSEEPSKKKDKKKKKKVEEEEPEKEEPSKKK
KKKKAEAETEAVEVAKEEKKNKKKRKHEEEETTETPAKKKDKKEKKKKSKD*

DNA
ATGGTCTTAGTGCTATACGAGACAGCGGCTGGTTTTGCCCTCTTTAAAGTGAAAGATGAAGGAAAGATGGCTAACGTTGA
GGATTTGTGTAAAGAGTTCGACACTCCAGACTCAGCACGAAAGATGGTTAAGCTAAAAGCTTTTGAGAAGTTTGACAACA
CATCTGAAGCTCTCGAAGCTGTGGCTAAATTGCTGGAGGGAGCTCCAAGCAAAGGTCTGCGCAAGTTTTTGAAAGCTAAT
TGTCAAGGTGAAACCTTAGCTGTGGCAGATTCAAAGCTTGGGAATGTGATCAAGGAGAAACTGAAAATTGATTGCATTCA
CAACAATGCTGTTATGGAGCTTCTACGAGGAGTTAGAAGTCAGTTTACTGAACTCATATCTGGGTTGGGTGATCAAGACT
TGGCACCTATGAGCTTGGGTCTGTCTCACAGTCTTGCCAGATATAAGCTAAAGTTTAGTTCTGACAAGGTGGATACCATG
ATTATCCAAGCTATCGGTTTACTTGATGATCTTGACAAAGAACTGAACACATACGCCATGAGGGTTAGAGAATGGTATGG
ATGGCATTTTCCCGAGCTTGCTAAGATCATATCAGACAATATCCTATATGCCAAATCTGTTAAATTGATGGGAAACAGAG
TTAATGCTGCAAAGCTAGACTTCTCCGAGATCTTAGCGGATGAAATTGAGGCAGATCTCAAGGACGCAGCTGTGATATCC
ATGGGAACAGAAGTCAGTGACCTAGACTTGTTGCACATTCGTGAACTCTGTGACCAGGTTCTTTCTCTTTCTGAGTACAG
AGCTCAGCTTTACGATTACCTGAAGAGCAGAATGAACACAATTGCTCCCAATCTGACTGCCCTTGTTGGAGAGCTAGTTG
GTGCCCGTCTGATTTCTCATGGAGGTAGTTTATTGAACCTCTCCAAGCAACCTGGGAGCACGATTCAGATACTCGGAGCT
GAAAAAGCTCTCTTTAGAGCTCTTAAGACAAAACACGCCACACCCAAGTACGGTTTGATTTACCACGCATCTGTGGTTGG
TCAAGCAGCACCAAAGCACAAGGGAAAGATCTCGCGGTCATTAGCTGCTAAAGCTGTTCTTGCTATTAGGGTTGATGCTC
TTGGTGATGGCCAGGATAGCACTATGGGACTTGAGAACCGAGCTAAGCTTGAAGCGCGGTTGAGAAATCTTGAAGGAAAA
GATTTAGGACGTCTGTCTGGTTCAGCTAAAGGCAAACCTAAGATTGAAGTCTATAACAAGGATAAAAAGATGGGATCTGG
CGGTCTTATCACTCCTGCTAAGACTTACAACACTGCTGCAGATTCTCTTCTTGGGGAATCCTCGGCTAAATCTGAGGAGC
CATCGAAGAAGAAAGATAAGAAAAAGAAGAAGAAGGTAGAAGAAGAGGAACCCGAAAAGGAGGAGCCATCAAAGAAGAAG
AAGAAGAAGAAAGCTGAAGCAGAAACTGAAGCCGTAGAGGTTGCAAAGGAGGAGAAGAAGAACAAGAAGAAGAGAAAGCA
TGAGGAAGAAGAAACAACTGAGACACCAGCCAAGAAGAAAGATAAGAAAGAGAAGAAAAAGAAGAGCAAGGACTGA