Details for Lyrate rockcress Locus 16048028

Position : sca3 ( 5`- 5607243 .. 5606677 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048028

Protein [Map View]
MTNYGAIPTSSHASPVVDLESLSRAKHRIKAGLATRRPWRVMFDFHSMGLPHSVSDAFTRIKTNLAYFRMNYAIVVLIVI
FFSLIWHPTSLIVFTVLVAVWIFLYFLRDEPIKLFRYQIDDRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHA
VVRKTEDLFLDEEAATTETSGLTSYPST*

DNA
ATGACGAACTACGGTGCGATTCCGACGTCGTCTCATGCATCTCCGGTGGTGGATCTTGAGTCTCTCTCACGCGCCAAGCA
CCGTATCAAAGCCGGACTAGCCACGCGCCGTCCTTGGAGAGTGATGTTCGATTTTCACTCCATGGGACTACCTCACAGCG
TCTCCGATGCTTTCACAAGAATCAAGACCAATCTTGCTTACTTCCGTATGAACTACGCAATCGTTGTCTTGATCGTTATC
TTCTTCAGCTTGATCTGGCATCCGACATCGCTCATCGTTTTCACCGTCTTGGTCGCTGTTTGGATCTTTCTTTATTTTCT
CCGTGATGAGCCTATCAAGCTGTTCCGATATCAGATCGATGATCGGACGGTCTTAATTGTTTTATCGGTGTTAACCGTCG
TTCTACTTTTGTTGACCAACGCGACGTTTAATATTGTTGGAGCGCTTGTGACCGGAGCTGTGTTGGTTTTGATCCATGCG
GTGGTTAGGAAGACAGAGGATCTTTTCTTGGATGAAGAAGCGGCGACGACTGAGACTTCTGGGCTGACGTCATACCCGTC
GACTTAA