Details for Lyrate rockcress Locus 16048021

Position : sca3 ( 5`- 6577141 .. 6575396 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048021

Protein [Map View]
MEKKKVATPLVCHGHSRPVVDLFYSPITPDGFFLISASKDSHPMLRNGETGDWIGTFEGHKGAVWSSCLDNNALRAASAS
ADFSAKLWDALTGDVLHSFEHKHIVRACAFSQDTKSLITGGFEKILRVFNLNRLDAPPTEIDKSPGSIRTLAWLHGDQTI
LSSCTDIGGVRLWDMRSGKIVQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSG
NKFVAGGEDMWVRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEENNESKPKQSVDEVT
RKIEGFHINKEGKTAEKPSDA*

DNA
ATGGAGAAGAAGAAAGTAGCGACTCCGCTAGTGTGCCATGGCCATTCAAGACCTGTTGTGGATTTGTTCTACAGTCCAAT
CACACCTGATGGTTTCTTCCTCATCAGCGCAAGCAAAGATTCTCATCCAATGTTGAGAAATGGGGAAACTGGAGATTGGA
TTGGTACATTTGAAGGGCATAAAGGTGCTGTGTGGAGTTCTTGTCTCGATAACAATGCTTTACGTGCAGCTTCCGCATCT
GCTGATTTTTCAGCGAAACTTTGGGATGCTTTGACCGGGGATGTCTTGCATTCTTTTGAGCACAAGCATATTGTTCGAGC
ATGCGCCTTCTCTCAGGATACGAAATCTCTGATCACAGGAGGATTTGAGAAAATTCTTCGTGTTTTCAACTTGAATCGCT
TGGATGCACCTCCTACAGAAATTGATAAATCTCCTGGTTCTATCAGAACACTAGCTTGGCTTCACGGTGATCAAACGATA
TTAAGTTCTTGCACCGATATTGGCGGTGTGAGGTTATGGGATATGAGGAGTGGCAAAATTGTGCAAACTCTAGAAACCAA
GTCTCCTGTCACCAGTGCTGAAGTGAGTCAAGATGGACGTTATATCACAACTGCCGACGGATCAACTGTTAAATTTTGGG
ATGCAAATCATTTTGGACTAGTGAAGAGTTACGACATGCCCTGCAATATCGAATCTGCGTCGCTTGAGCCTAAATCTGGC
AACAAATTCGTTGCTGGTGGAGAAGATATGTGGGTTCGACTCTTTGATTTCCACACCGGAGAGGAGATTGGATGCAACAA
GGGACATCATGGTCCAGTTCACTGTGTGAGATTTGCACCAACAGGTGAGTCTTATGCTTCAGGATCTGAAGATGGTACCA
TCAGAATCTGGCAAACTGGTCCGGTGAATCCTGAAGAGAACAACGAATCAAAGCCGAAGCAGAGTGTGGATGAGGTCACT
CGTAAGATTGAAGGCTTTCACATTAACAAGGAAGGGAAAACCGCAGAGAAACCATCTGATGCTTAA