Details for Lyrate rockcress Locus 16048019

Position : sca1 ( 5`- 7749404 .. 7752632 -3` )
Annotation : [B2G] lipase family protein
External links : CoGe
PGDD synteny : 16048019

Protein [Map View]
MQRIVDNALAVTKESVKTLTYESLNNIARCINGFSALLLTLLPGKSNVLEGLHGWELRPTLRGPRLPRWMHNGVSSFNHF
IHELSVDSDTSSLDYSSGEDDSDGISTPPSPLSQSSLRSWASLPTNYESHWTDWITFIVWWVLLPARILLWLPLYLLRLL
GTRNSRMSPMSPGRYQHSSRPYFSKAIPGKEHDVPNRTTDKRRGVIEDLQLGIEIFIETIFDFFHKAAHLLLSPSETFGI
VLSWFSSSSHSSKGNYGDASDDEIVQTAILGDSDSSPTERRTTTSLYNTDTRTCQDVITELGYPYEAIRVVTSDGYGLLL
ERIPRRDARKAVYLQHGVMDSSMGWVSNGVVGSPAFAAYDQGYDVFLGNFRGLVSRDHVNKNISSKDFWRYSINEHATED
IPAMIKKIHEIKTSELKLYQPTMEEVVNEEQPYKLCVISHSLGGAAVLMYVITRKIEEKPHRLSRLILLSPAGFHDDSNM
CFTLMEYTFLLLGPVLSRIVPAFYIPTKFFRMLLNKLARDFHNYPAVGGLVQTLMSYVVGGDSSNWVGVMGLPHYNMNDM
PGISFRVAQHLAQIKHSGKFKMFDYGSSSANMEVYGSPEPLDLGEFYGLIDVPVDLVAGKKDKVIRPSMVRKHYRVMRDS
GVDVSYNEFEYAHLDFTFSHREELLAYVMSRLLLVEPTPTQTNHKKGMKLKKKMETGKPHL*

DNA
ATGCAGAGGATCGTCGATAATGCTCTTGCTGTCACAAAAGAGTCAGTGAAAACTTTGACTTATGAGTCTTTGAACAACAT
TGCAAGATGCATTAATGGATTTTCTGCACTTCTCTTGACACTTTTGCCCGGAAAGTCCAATGTTCTTGAAGGTCTTCATG
GATGGGAGCTAAGGCCTACATTACGTGGCCCTCGTTTACCACGTTGGATGCATAATGGAGTCTCTTCTTTCAACCACTTC
ATTCATGAGCTCTCTGTGGATTCTGATACTTCAAGCTTGGACTATTCCTCTGGAGAAGATGATAGTGATGGCATCTCCAC
GCCTCCATCACCCTTGTCTCAAAGCTCACTCCGCTCTTGGGCTAGTCTTCCTACAAATTACGAAAGCCATTGGACAGACT
GGATAACCTTCATTGTCTGGTGGGTTTTACTACCTGCCCGGATTCTTCTATGGTTACCATTATATCTTTTGCGTCTTTTG
GGTACACGAAATTCAAGAATGTCACCTATGAGCCCAGGAAGGTACCAACATTCTTCTAGACCTTATTTTAGCAAAGCTAT
CCCAGGGAAAGAGCATGACGTCCCTAACCGAACTACTGATAAAAGACGCGGAGTCATTGAGGATCTTCAGCTTGGTATCG
AGATCTTTATAGAAACAATATTTGATTTTTTTCACAAGGCGGCACATCTTCTTCTTTCTCCATCAGAGACTTTTGGAATA
GTTTTATCGTGGTTCTCTTCCTCCAGTCACAGCTCTAAAGGAAACTATGGCGACGCTTCGGATGATGAGATCGTGCAGAC
TGCCATTCTAGGAGATAGTGATTCATCTCCTACAGAAAGAAGAACCACAACGAGTTTATACAATACAGATACTCGGACTT
GTCAGGATGTTATTACAGAGCTTGGGTATCCGTATGAAGCTATTCGTGTTGTTACATCTGATGGATATGGTCTTCTCTTG
GAAAGGATACCAAGACGAGATGCAAGGAAAGCTGTTTACTTGCAGCATGGTGTAATGGATTCTTCAATGGGATGGGTATC
AAATGGTGTTGTTGGATCTCCGGCTTTTGCTGCTTATGATCAAGGCTACGATGTTTTCCTAGGGAACTTTCGTGGTTTAG
TTTCAAGAGATCATGTAAACAAAAACATATCCTCAAAAGATTTCTGGCGTTACTCCATCAATGAGCATGCAACGGAAGAT
ATCCCAGCAATGATAAAGAAGATTCACGAAATCAAAACTTCAGAACTGAAACTTTATCAGCCTACTATGGAAGAGGTAGT
AAACGAGGAGCAACCGTATAAGCTCTGTGTAATATCTCACAGTTTAGGCGGCGCCGCGGTTCTGATGTATGTAATCACCC
GTAAAATCGAAGAGAAACCGCACAGACTCTCGAGACTGATCCTGCTTTCGCCTGCTGGGTTTCACGATGACTCCAACATG
TGTTTCACGTTGATGGAGTACACATTCCTTCTCTTGGGCCCTGTACTATCTCGGATTGTTCCTGCTTTCTACATCCCCAC
TAAATTCTTCCGGATGCTTCTCAACAAGTTAGCTCGAGATTTTCATAACTATCCTGCTGTTGGTGGATTAGTCCAGACAT
TGATGAGTTATGTAGTTGGCGGAGATAGCTCAAACTGGGTTGGAGTCATGGGATTGCCTCACTATAACATGAACGATATG
CCAGGTATATCCTTCCGTGTGGCTCAGCATCTTGCGCAGATTAAACATAGCGGTAAGTTCAAGATGTTTGATTACGGTAG
CAGTTCAGCTAATATGGAGGTTTACGGGTCCCCTGAGCCACTCGACCTTGGGGAGTTTTACGGGTTGATCGATGTGCCTG
TGGATTTAGTAGCCGGAAAGAAAGATAAAGTGATTAGACCTTCAATGGTTAGGAAACATTACAGGGTGATGAGAGATTCA
GGAGTTGATGTTTCTTACAATGAGTTTGAGTATGCTCATTTGGATTTTACCTTCTCTCACCGTGAAGAGCTTTTGGCTTA
TGTGATGTCGCGGTTACTGCTCGTGGAGCCAACGCCCACTCAGACGAATCATAAGAAGGGGATGAAGCTGAAGAAGAAGA
TGGAAACAGGCAAACCTCATCTATGA