Details for Lyrate rockcress Locus 16048003

Position : sca3 ( 5`- 3716264 .. 3718107 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16048003

Protein [Map View]
MAKDGPNWDGLLKWSLSHADGTRPTRQLSEEDRKWFMEAMQSQTIDVVKRMKEITLVMQTPEQVLADHGVTPEDIQDLLD
ELQEHVESIDMANDLHSIGGLVPLLNFLKNSHANIRAKAADVVSTIVQNNPRSQELVMETNGLESLLSNFTSDTDIHART
QALGAISSLIRHNKPGVTAFKLANGYAGLRDALASDSVRFQRKALNLLQYLLQEDDSDRSIATGLGFPRVMMHLASSDDA
EIREAALRGLLELAREKNDGSGSSSIDKSDEKLRQLLEERIKGISLMSQEDLETVKEERQLVDSLWSICYNEPSSLREKG
LLVLPGEDELPPDVASKLFEPPLRATAANRNATEKKDEPMKLLGP*

DNA
ATGGCGAAAGACGGACCTAATTGGGACGGATTACTTAAATGGAGTCTCTCTCACGCTGACGGGACTCGACCCACTCGCCA
GTTGAGTGAGGAGGATCGAAAATGGTTTATGGAGGCTATGCAATCACAGACTATAGATGTAGTCAAGCGCATGAAGGAGA
TTACACTAGTTATGCAAACACCTGAACAAGTTTTAGCGGATCATGGAGTTACACCTGAGGATATTCAAGATTTGCTGGAT
GAGCTGCAGGAGCACGTTGAATCAATCGATATGGCTAATGATCTTCATTCAATTGGAGGCTTGGTTCCTCTTCTTAATTT
CCTTAAAAACTCTCATGCTAATATTCGGGCAAAAGCTGCGGATGTCGTTAGCACAATAGTTCAGAACAATCCCAGAAGTC
AGGAACTAGTTATGGAAACAAATGGTTTGGAGTCATTACTCTCAAATTTCACTTCAGACACAGATATTCACGCTCGAACC
CAGGCCCTTGGCGCAATATCATCTTTGATTCGCCATAACAAACCAGGAGTAACTGCTTTCAAGCTTGCCAATGGTTATGC
TGGCCTAAGAGATGCTTTAGCATCTGATAGTGTGAGATTTCAAAGGAAAGCCTTAAACTTGTTGCAATATCTACTGCAAG
AGGATGATTCAGACCGCAGTATTGCGACTGGACTCGGATTCCCCCGAGTGATGATGCATCTCGCCTCTAGTGACGATGCT
GAGATCAGAGAAGCCGCTCTTCGTGGATTGCTTGAGCTTGCAAGAGAGAAAAACGATGGAAGCGGAAGTAGCAGCATAGA
TAAAAGCGATGAGAAACTGAGGCAGCTACTAGAAGAACGGATCAAAGGAATCAGCTTGATGTCACAGGAGGATCTTGAAA
CGGTTAAAGAAGAGAGACAGCTCGTCGATTCACTGTGGAGCATTTGCTACAATGAACCTTCTTCTCTGAGAGAAAAAGGG
CTTCTCGTTCTTCCGGGTGAAGACGAATTGCCTCCTGATGTCGCAAGCAAGCTCTTTGAGCCTCCTCTTAGAGCCACTGC
AGCAAACCGTAATGCTACTGAGAAGAAAGATGAACCTATGAAACTACTTGGACCATAA