Details for Lyrate rockcress Locus 16047997

Position : sca3 ( 5`- 6778144 .. 6782215 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318392 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047997

Protein [Map View]
MTATTTLKSFNYLSLINHRLNHNTYAILSSRLPRFHQPATSSFSNSGFRFFQSNHLFFSSQSGSLMEVFKAAFSEGSNSC
DRIAIKADGKSYSYGQLTSSAFRISKLFSNEDTTNGGETKKYEGFGSLKGARIGIVAKPSAEFVAGVMGTWFSGGVAVPL
ALSYPEAELLHVMNDSDISLLLSTEDHSETMKTIAAKSGAQFHLIPPVVNSTSETVARNQFQDDSFEAEGKFLDDPALIV
YTSGTTGKPKGVVHTHNSINSQVKMLTEAWEYTSTDHFLHCLPLHHVHGLFNALFAPLYARSLVEFLPKFSVSGIWRRWR
ESYPQNDEKNNDAITVFTGVPTMYTRLIQGYEAMDKEMQDSSAFAARKLRLMMSGSSALPRPVMHQWESITGHRLLERYG
MTEFVMAMSNPLRGARKAGTVGKPLPGVEAKIKEDENDSNGVGEICVKSPSLFKEYWNLPEVTKESFTEDGYFKTGDAGR
VDEDGYYVILGRNSADIMKVGGYKLSALEIESTLLEHPTVAECCVLGVTDKDYGEAVTAIIVAESAIKKRREDESKPVMT
LEELCGWAKDKLAPYKLPTRLLIWESLPRNAMGKVSKKELKKSLDNQE*

DNA
ATGACCGCTACGACGACATTAAAGAGTTTCAACTACTTGTCTTTAATTAACCATCGACTCAACCACAACACATACGCTAT
TCTCTCTTCTCGTCTTCCTCGATTTCATCAGCCAGCTACCTCTTCGTTTTCCAATTCTGGGTTTCGATTCTTCCAATCTA
ACCATCTCTTCTTCTCTTCACAGTCTGGTTCACTCATGGAAGTGTTTAAAGCAGCTTTTTCAGAAGGTTCTAATTCCTGT
GATAGGATTGCGATTAAAGCCGATGGAAAGAGTTACTCTTATGGCCAGCTAACGTCCTCTGCTTTTAGAATATCTAAATT
GTTCTCCAATGAAGATACTACAAATGGAGGTGAAACTAAGAAGTATGAAGGGTTTGGTAGTCTTAAAGGAGCTAGAATTG
GAATTGTGGCAAAACCTTCAGCTGAGTTTGTTGCAGGAGTTATGGGAACATGGTTTAGCGGTGGTGTAGCGGTTCCACTT
GCACTCAGCTATCCTGAGGCTGAACTCTTACATGTCATGAATGATTCGGATATATCCCTGTTATTGAGCACAGAGGACCA
TAGTGAAACTATGAAAACTATCGCAGCAAAGAGTGGTGCCCAATTTCATCTTATTCCTCCTGTTGTCAACTCAACTTCGG
AAACTGTTGCTCGCAATCAGTTTCAGGATGATAGTTTTGAAGCAGAAGGAAAGTTTCTAGATGATCCAGCATTGATTGTC
TACACTAGTGGCACAACTGGTAAGCCAAAAGGAGTTGTCCATACCCACAACAGCATCAATTCCCAGGTTAAAATGCTCAC
TGAAGCTTGGGAGTACACATCTACTGATCATTTTCTCCACTGCCTCCCACTACATCATGTTCATGGGCTTTTCAACGCTT
TATTTGCTCCTCTTTACGCACGGTCTTTGGTGGAGTTTTTGCCCAAATTTAGTGTTAGTGGAATCTGGCGTAGATGGCGT
GAATCCTATCCACAGAATGATGAGAAAAACAACGACGCTATAACTGTATTCACTGGAGTTCCAACCATGTACACTCGGTT
GATACAAGGTTATGAAGCAATGGATAAAGAGATGCAGGACTCGAGCGCTTTTGCTGCACGGAAGCTTCGCCTAATGATGT
CTGGGTCCTCTGCTCTCCCTCGACCTGTCATGCATCAATGGGAAAGTATCACAGGTCATCGTCTTTTGGAAAGATATGGC
ATGACTGAGTTTGTAATGGCAATGTCGAACCCCTTACGGGGTGCACGAAAGGCTGGTACTGTCGGCAAACCGCTTCCTGG
TGTGGAGGCTAAAATTAAAGAAGATGAGAATGATTCAAATGGAGTGGGCGAGATTTGTGTTAAAAGCCCATCTTTGTTCA
AGGAGTATTGGAATCTTCCAGAAGTGACGAAAGAATCATTTACGGAAGATGGATACTTTAAGACAGGAGATGCTGGTAGA
GTGGATGAGGATGGATATTATGTGATTCTAGGACGCAATAGCGCTGACATTATGAAGGTTGGAGGATACAAGTTATCAGC
TTTAGAAATCGAATCAACGCTTCTCGAGCACCCTACGGTTGCAGAATGTTGCGTGTTGGGGGTAACAGACAAAGATTATG
GAGAAGCCGTTACTGCGATAATTGTAGCAGAGAGTGCAATAAAGAAAAGAAGAGAAGATGAGTCAAAACCTGTAATGACC
TTAGAAGAACTGTGCGGTTGGGCTAAAGACAAGCTTGCTCCTTACAAGCTACCAACACGATTGCTGATATGGGAGAGCTT
GCCCCGCAACGCCATGGGAAAGGTGAGCAAAAAAGAGCTAAAGAAATCTCTGGATAATCAAGAATAA