Details for Lyrate rockcress Locus 16047957

Position : sca3 ( 5`- 7962777 .. 7964586 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047957

Protein [Map View]
MNNNTFSTLTTINDDYMLFPYNDHNSSQPLLPFSPSSSINDILIHSTSNNHHHQFLQPSPFSQFEFVPDCALLTTFHPQN
NGHDDNQTIPNDNHHPSLHFPLNNTIGDQPAEPSETITHIEDSQRISDPKMKKVKKLGRTDRHSKIKTAKGTRDRRMRLS
LDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKIAKTLSYQCSFSSGDESHTRPELRSMDTSSDLCELPSMWTVDDR
GSNTNTTETRGNKVDGRSMRGKRKRPEPRTPILKKLSKDERAKARERAKDRTMEKMMMKMKGRSQLVKVVEEEAHHHGEI
MKNTISEVNRNSFEMSHCEDEIEKLCKNDRFAVCNEFVMNKKDHISNESYDIVNYKLNSSFPVINHHRSQGAANSIEQHQ
FTDLHNSLVAKPDLMYNYQNMY*

DNA
ATGAACAACAACACTTTCAGTACTCTTACCACCATCAATGACGACTACATGTTATTCCCTTATAATGACCATAATTCCTC
ACAGCCATTGCTCCCTTTTAGCCCTTCTTCTTCCATTAACGATATCTTGATTCACTCCACATCAAACAATCATCATCATC
AATTCCTACAACCTTCTCCTTTTTCTCAATTCGAATTTGTCCCGGATTGTGCCCTCCTCACCACTTTCCACCCACAAAAC
AATGGCCATGATGATAACCAAACCATCCCCAACGACAATCATCATCCATCACTTCACTTTCCCTTGAATAACACCATTGG
AGACCAGCCCGCTGAGCCCTCGGAAACTATAACCCACATAGAAGATTCCCAGAGAATCTCAGACCCAAAAATGAAAAAAG
TCAAGAAACTAGGCAGAACGGACAGGCACAGCAAGATCAAAACGGCCAAAGGGACAAGAGATCGTAGGATGAGACTCTCG
CTAGATGTCGCCAAAGAGTTGTTTGGCTTACAAGACATGCTTGGATTCGATAAAGCCAGCAAAACCGTTGAATGGTTGCT
CACACAAGCGAAACCCGAGATAATAAAGATCGCCAAAACCCTTTCTTACCAATGCAGCTTCAGCAGCGGCGACGAGTCTC
ATACCCGACCGGAGTTAAGATCCATGGACACATCATCTGATCTATGTGAACTTCCATCAATGTGGACGGTCGACGATAGA
GGCAGCAATACTAACACGACCGAAACAAGAGGAAACAAGGTAGACGGTAGGTCAATGAGAGGGAAGAGAAAGAGGCCAGA
ACCGCGAACGCCCATTTTGAAGAAGTTGTCCAAGGACGAGAGAGCGAAAGCAAGAGAAAGAGCAAAGGATAGAACAATGG
AGAAAATGATGATGAAGATGAAAGGAAGATCACAATTAGTTAAAGTTGTGGAAGAAGAAGCTCATCATCATGGTGAGATC
ATGAAGAATACTATTAGCGAAGTGAATCGGAATTCTTTTGAGATGTCACACTGCGAAGACGAGATCGAAAAACTTTGCAA
GAACGATCGATTTGCAGTTTGCAACGAATTTGTCATGAATAAGAAAGATCACATTTCAAACGAATCTTATGACATAGTCA
ACTACAAATTGAACTCATCATTTCCAGTGATTAATCACCACCGCAGCCAAGGGGCAGCTAATTCCATTGAGCAGCATCAG
TTTACGGATCTTCATAACTCCTTGGTGGCGAAACCAGACCTCATGTACAACTATCAAAACATGTATTGA