Details for Lyrate rockcress Locus 16047952

Position : sca3 ( 5`- 11982231 .. 11979623 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047952

Protein [Map View]
MKMYPKSDSDITSLDLSSPKLPTYYVQSPSRDSDKSSSVALTTHQTTPTESPSHPSFASRVSNNGGGGFRWKGRRKYHGG
RWWPADKEDDADDGRYEDLYEDNRGVSIVTCRLILGVVATLSIFFLLCSVLFGVSQSFPPIVYIKGVNVQSFYYGEGSDS
TGVPTKIMNFKCSVDITTHNPSTLFGIHVSSTTINLVYSRQFTLAIAQLKSYYQPKLSNHTSRINLVGSKVPLYGAGAEL
VASDHIGGVPVHTPNYTILSESRLSSSSRTSNGTSGMGFRWKGSSRRSNMYWPEKPYTINEDEVYDDNRGLSVGQCRAVL
VILGTVVVFSVFCSVLWGASHPFSPIVSVKSFNIHSFYYGEGIDRTGVATKILSFNSSVKVTIDSPAPYFGIHVSSSTFK
LTFSALTLATGQLKSYYQPRKSKHIAIVKLTGAEVPLYGAGPHLAASDKKGKVPVKLEFEIRSRGNLLGKLVKSKHVNHV
SCSFFISSSKTSKPIEFSHKTCKLVTK*

DNA
ATGAAGATGTACCCAAAATCTGACTCAGACATCACAAGCCTCGACCTATCATCACCAAAACTTCCTACTTACTACGTTCA
AAGCCCATCACGTGACTCCGACAAGTCTTCTTCGGTGGCACTGACGACTCATCAGACCACTCCCACCGAGTCGCCATCAC
ACCCATCATTTGCTAGCCGCGTATCCAACAACGGTGGTGGAGGTTTCCGGTGGAAAGGACGGAGGAAATATCACGGTGGA
AGATGGTGGCCGGCTGATAAGGAGGATGATGCTGATGATGGGCGGTACGAGGATCTTTATGAGGACAACAGAGGAGTCTC
CATTGTTACTTGTAGACTTATTTTGGGAGTTGTTGCGACATTGAGTATCTTTTTTCTTCTATGTTCTGTTCTCTTTGGTG
TTTCTCAATCTTTCCCTCCAATCGTCTACATCAAGGGTGTGAATGTGCAAAGTTTTTACTACGGAGAAGGTTCAGATAGT
ACAGGAGTGCCAACAAAGATCATGAACTTTAAATGTTCAGTGGACATCACAACACACAATCCTTCTACATTATTCGGCAT
TCATGTCAGCTCCACTACCATCAACCTCGTCTACTCTCGTCAATTCACGCTTGCGATCGCGCAGCTGAAGAGTTATTATC
AACCAAAACTAAGCAACCACACATCTAGGATCAACCTTGTTGGCTCCAAGGTTCCACTATATGGAGCAGGAGCCGAGTTA
GTTGCTTCAGACCATATTGGTGGAGTTCCTGTTCATACTCCAAACTACACCATTCTCAGTGAGTCACGTCTCTCCTCTTC
GAGCCGTACCTCCAATGGAACAAGCGGTATGGGATTCCGATGGAAAGGAAGCTCCCGGAGAAGTAATATGTATTGGCCGG
AGAAGCCTTACACGATTAATGAAGATGAAGTTTATGATGATAACAGAGGATTATCGGTGGGACAATGCAGAGCTGTTTTG
GTAATATTAGGTACTGTGGTTGTGTTCTCTGTTTTCTGCTCTGTTTTGTGGGGAGCTTCTCATCCTTTCTCTCCTATTGT
CTCTGTCAAGAGCTTTAACATCCATAGCTTTTATTACGGAGAAGGAATAGACAGAACAGGAGTTGCTACCAAGATTCTGA
GCTTTAACAGCTCGGTGAAGGTGACAATAGATAGTCCTGCGCCTTACTTTGGCATCCATGTCTCTTCTTCTACCTTCAAA
CTCACCTTCTCTGCTCTCACACTCGCCACTGGTCAGCTTAAGAGCTATTACCAGCCAAGAAAGAGCAAGCACATAGCCAT
TGTAAAGCTCACTGGCGCCGAAGTTCCTTTGTATGGAGCAGGACCACACTTAGCTGCCTCTGACAAGAAGGGAAAAGTTC
CAGTGAAGTTGGAGTTTGAGATCCGATCGCGAGGTAATTTATTGGGGAAGCTGGTCAAGTCGAAGCACGTGAATCACGTA
TCATGCTCTTTCTTCATCTCCTCCTCCAAGACTTCCAAACCCATAGAATTCAGTCATAAGACCTGTAAACTTGTTACCAA
GTAA