Details for Lyrate rockcress Locus 16047912

Position : sca3 ( 5`- 2181370 .. 2171106 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047912

Protein [Map View]
MSMVGYLNVDNIFVRATSPPSFALEVFVRCEGESKFKRLCNPFLYTPSAPYPLEVEAVVTNHLVVRGSYRSLSLIVYGNI
VKDLGQYNIILEGRSVTDIVSSTEGNLEDLPLVLHSVNRTIEECLSSLDIVSLPLATVDVPVEVKRLLQLLLKVFDKLAT
SDVVNKFVDTVVSGVSSYVTDNVDFFLKNKNCPAVASSVDSGLFHDIIDKVKKDILDLNEIQESDVALGVFSFLESETCL
ATSQQLVDMLSPYIQFERDSLCTVLPQLSKGKATLLGLSLAFLLCSGREGCLQFVNSGGMDQLVYFFGHDVQNSTTITLL
LLGVVEQATRHSVGCEGFLGWWPREDGSIPSGKSEGYCLLLKLLMQKPCHEIASLAIYILRRLRIYEVISRYEFAVLSAL
EGLSNSHAAATHNLDMLSDAKSQLQKLQNLMKSLGSVEDPSPSAYAERSLVSDHSEGWLSYKATSKLTASWACPFYSSGI
DSHMLALLTERGFLPLSAALLSMPGLHSKVGDLMDVFTDIAMFIGNIILSLMFSRTGLSFLLHHPELTATIIQSLKGSVD
LNKEECVPLHYASILISKGFTCSLLEIGINLEMHLRVVSAVDRLLKSTQQTEEFLWILWELRDVSRSDCGREALLTLGVF
PEALVVLIEALHSAKDMEPAVENSGISPLNLAICHSAAEIFEVIVSDSTASCLHAWIEHAPVLHKALHTLSPGGSNRKDA
PSRLLKWIDAGVVYHKHGVVGLLRYAAVLASGGDAQLSSSSILALDLTQAENGAGESTNVSEMNVLDNLGKVIFEKSFEG
VNLSDSSISQLTTALRILALISDNSVYAVVFLFKCSEMLCFVQTVAAALYDEGAVTVVYAILGTKEQYRNTKLMKALLRL
HREVSPKLAACAADLSSHYPDSALGFGAVCHLIVSALVCWPVYGWIPGLFHTLLSGVQTSSVPALGPKETCSFLCILTDI
LPEEGVWFWKSGMPLLSGLRKLAVGTLMGPQKEKQINWYLEAGPLEKLINHLTPNLEKIAKIIQHHAVSALVVIQDMLRV
FIVRIACQRVEHASILLRPIFSSIRDGILDQSSTRNTEAYMVYRYLNFLASLLEHPHAKGLLLEEGIVQLLVEVLERCYD
ATYPSENRVLEYGIVSESSVIQWCIPAFRSISLLCDSQVPLLCFQKKELLASLSAKDCALILPFVLKFCQVLPVGNELLS
CLGAFKDLISCGEGQDGLVSLLFQLFSGAEEPVSERWCDTHNLSLDQLEMKKNPPFLSCWIKLLNSINSKDGLSSLAIKA
VNVLSVGSIRLCLDGKSLNSRKVAGLKSLFGLPSEFSGTDTFREENIGLIEQMVTLLSSTTSGSDSSETAEMKPYLHEAS
RSLLSLLKDGNIDDIISCKGVLVSPGNFDMDDLDSENIEDDLYQRGLEDKFWWECPETLPERLPQSSLPAKRKLSTLESS
SRRAKGENSSVDIPTQNSVHRALGSLSLPPAPTRRDTFRQRKPNTSRPPSMHVDDYVARERSVDTAGNSNAITISRAGSS
SGRPPSIHVDEFMARQRERGQNPSTIVVGEAVVQVKNPTPARDSEKVAGKPKQFKADPDDDLQGIDIVFDGEECEGPDDK
LPFLQPDENLMQPSPVMVEQNSPHSIVEETESDANGSSQFSHMGTPVASNVDENVQSEFSSRISVSRPDMSLIREPSISS
DRKFVEQADESKKMAPLKSAGISESVFVPAYNMPGSSGQNLIDPRVGPQGFYSKSSQQHTGHIHSGFSGRGVYEQKVMPN
QPPLPLVPPQSVSPVIPHSSDSLSNQSSPFISHGTQSSGGPIRLTPPLPSAMPQYSSNPYASLPPRTSTTQSFGYSQAGV
GTTEQQQSGPVIDHQSGNLSVSGTGMISYPPHTLMSAHNFSRPSSLPVPFYANPSHQGGDKPQTMLSVPSIPQSLNPQSI
PQLQSMQLSQLQRPMQPPQHVRPPIQISQPSEQGVSMQNPFQIPMHQMQMMQQTQVQPYYHTPQQQDLSQVQQQPQHHAV
QGQQGAGTSQQQDSGMSLHDYFKSPEAIQSLLSDRDKLCQLLEQHPKLMQMLQEKLGQL*

DNA
ATGTCTATGGTTGGTTATCTAAATGTTGACAATATTTTCGTTAGGGCAACTTCACCTCCTTCATTTGCATTGGAAGTGTT
CGTTCGATGTGAAGGAGAATCAAAATTTAAGCGACTTTGTAATCCTTTTCTTTACACTCCTTCAGCGCCCTACCCTTTGG
AAGTGGAGGCTGTTGTAACAAACCATCTGGTGGTTAGAGGCAGCTATCGAAGTTTGAGCTTGATCGTCTATGGGAACATC
GTGAAAGATTTGGGGCAGTACAATATCATTCTTGAAGGTCGTTCTGTAACTGATATTGTGAGTTCCACTGAGGGTAATCT
TGAGGACTTGCCATTGGTACTGCACTCAGTTAACAGAACAATAGAGGAATGTCTATCCTCTCTAGACATAGTATCTCTCC
CCCTCGCTACTGTAGATGTGCCTGTGGAAGTAAAGCGATTGTTGCAGCTGCTGCTAAAAGTCTTTGATAAGCTAGCTACT
AGTGATGTAGTAAATAAATTTGTGGATACGGTAGTGTCTGGGGTCTCGTCTTATGTCACAGACAATGTAGATTTCTTTTT
AAAGAATAAGAATTGTCCGGCCGTGGCCAGTTCCGTAGATTCTGGGTTATTTCATGATATAATTGACAAGGTTAAGAAAG
ATATTCTTGATCTCAATGAAATTCAAGAATCAGATGTGGCACTAGGAGTGTTCAGTTTTCTTGAATCAGAGACTTGTTTG
GCTACTTCACAACAATTGGTTGATATGTTGAGCCCATATATTCAGTTTGAAAGAGATTCCTTATGTACTGTCCTTCCACA
GCTTTCAAAGGGAAAAGCCACTCTTTTGGGTTTAAGTTTGGCCTTCTTATTATGCTCTGGCCGAGAAGGCTGCCTCCAAT
TTGTCAATTCCGGTGGGATGGATCAACTTGTATATTTCTTTGGTCATGATGTTCAGAATTCTACCACCATTACATTGTTG
TTGCTTGGAGTTGTTGAGCAGGCTACACGCCATTCAGTTGGGTGTGAAGGATTTTTAGGTTGGTGGCCTCGTGAGGATGG
AAGTATCCCATCTGGGAAGAGTGAGGGCTACTGTCTTCTGTTGAAATTACTTATGCAGAAACCATGCCATGAGATTGCCT
CTCTTGCAATTTATATTCTTCGTCGTTTGAGAATTTACGAGGTTATATCAAGATATGAGTTTGCAGTGTTGTCAGCATTG
GAAGGTCTCTCCAATTCTCATGCGGCTGCAACTCATAATCTGGATATGCTATCTGATGCTAAGTCACAACTTCAAAAGCT
CCAGAACCTGATGAAGTCACTTGGATCAGTTGAAGATCCCTCACCATCAGCCTACGCAGAAAGAAGTTTGGTTTCTGATC
ATTCGGAAGGCTGGTTGTCATACAAAGCCACGAGTAAACTAACTGCTTCATGGGCATGTCCGTTTTATAGCTCTGGAATT
GATTCGCACATGTTGGCACTTCTGACGGAGCGGGGTTTTCTTCCTTTGTCAGCAGCACTTCTCTCAATGCCTGGATTGCA
TTCTAAAGTTGGAGACCTTATGGATGTCTTTACTGATATCGCAATGTTTATTGGCAACATAATTCTTTCATTGATGTTTT
CACGCACAGGATTGAGCTTTTTGCTACATCATCCTGAACTGACTGCTACAATAATACAATCTCTGAAGGGATCCGTCGAT
CTGAACAAGGAGGAGTGTGTCCCCCTCCACTATGCTTCAATTTTAATATCCAAGGGTTTTACTTGCAGCTTACTGGAAAT
TGGAATAAATCTTGAGATGCATTTGAGGGTGGTGAGTGCGGTAGATCGTTTGCTCAAGTCGACACAACAAACAGAAGAAT
TTCTATGGATTTTATGGGAGTTGCGTGATGTTTCTAGGTCTGATTGTGGGCGTGAAGCTTTATTGACGTTAGGTGTTTTT
CCAGAGGCTTTAGTAGTCTTGATTGAAGCTTTGCATTCAGCCAAGGATATGGAGCCAGCAGTTGAAAATAGTGGAATTTC
ACCGCTTAATCTAGCAATATGTCACTCAGCTGCTGAGATTTTTGAGGTCATAGTCTCTGACTCAACTGCATCATGCTTGC
ATGCTTGGATTGAACATGCCCCAGTCCTTCATAAGGCCTTGCATACTTTGTCACCGGGTGGTTCTAATCGAAAAGATGCT
CCTTCACGATTACTTAAATGGATTGATGCGGGTGTGGTTTATCACAAGCATGGTGTAGTTGGCCTTTTACGTTATGCTGC
TGTCTTGGCTTCTGGAGGGGACGCCCAATTATCATCATCAAGCATCCTTGCACTGGATTTAACACAGGCTGAGAATGGTG
CTGGAGAATCAACAAATGTCTCTGAGATGAACGTCCTAGATAATCTTGGAAAAGTTATCTTTGAGAAATCTTTCGAAGGT
GTTAACCTTTCTGATTCATCAATTTCACAGTTGACAACAGCACTTCGAATTTTAGCGCTGATTTCAGATAATTCAGTATA
TGCTGTAGTCTTCTTATTTAAGTGTTCTGAAATGCTGTGCTTTGTACAGACTGTTGCTGCTGCTTTATATGACGAGGGTG
CGGTTACAGTTGTGTATGCTATCTTGGGAACTAAGGAGCAGTATAGAAACACCAAACTGATGAAGGCACTCCTAAGGCTA
CATCGGGAAGTCAGCCCGAAGCTAGCTGCTTGTGCAGCTGACTTGTCCTCCCATTATCCGGACTCTGCTCTTGGCTTTGG
AGCAGTGTGCCACCTCATTGTGTCCGCCCTTGTCTGCTGGCCAGTTTATGGATGGATTCCTGGACTATTCCACACTCTTC
TTTCGGGTGTCCAGACGTCTTCTGTTCCTGCCTTGGGTCCAAAGGAGACCTGTAGTTTCCTCTGCATTCTAACCGATATT
CTCCCTGAAGAAGGAGTCTGGTTTTGGAAGAGTGGCATGCCCTTATTAAGTGGTCTCAGAAAGTTGGCGGTTGGGACATT
GATGGGTCCACAGAAGGAGAAACAGATCAACTGGTATCTGGAGGCTGGTCCTCTTGAAAAGCTGATAAACCATTTGACTC
CTAATCTTGAAAAGATTGCAAAGATTATCCAACATCATGCAGTATCTGCATTGGTGGTCATTCAGGATATGCTTCGGGTT
TTCATAGTTCGTATTGCATGTCAAAGGGTTGAGCATGCTTCTATCCTTCTGAGGCCCATATTTTCATCTATCAGAGATGG
TATTTTGGATCAGTCATCAACAAGAAACACTGAAGCTTATATGGTCTACAGATATCTTAATTTTCTGGCTAGTTTATTAG
AGCACCCGCATGCTAAGGGATTACTCTTAGAGGAGGGTATTGTTCAACTCCTTGTGGAAGTTCTGGAAAGATGTTATGAT
GCCACTTATCCAAGTGAAAACAGGGTTCTAGAGTATGGAATTGTGTCCGAGTCTAGTGTGATTCAGTGGTGTATTCCAGC
TTTCAGATCGATCTCACTGCTATGTGATTCACAAGTGCCTCTCTTGTGCTTTCAGAAGAAAGAGCTATTGGCCAGTTTGA
GTGCAAAAGATTGTGCATTGATTTTACCCTTTGTGCTGAAGTTCTGCCAGGTCTTGCCTGTTGGCAATGAGCTATTATCT
TGTCTCGGCGCTTTCAAAGACCTGATCTCATGTGGTGAAGGTCAAGATGGTCTGGTTTCACTTTTGTTTCAATTGTTTTC
TGGTGCCGAAGAACCTGTATCTGAAAGGTGGTGTGACACTCATAATTTGAGTCTCGATCAACTAGAAATGAAGAAAAATC
CCCCTTTTCTATCTTGCTGGATCAAGTTATTGAACTCAATTAATTCAAAAGATGGTTTGTCTAGTCTTGCAATTAAGGCA
GTAAACGTTCTGAGCGTGGGCTCCATCAGATTATGCCTTGATGGTAAAAGTTTGAACTCGAGGAAGGTTGCAGGACTAAA
ATCCCTCTTTGGCCTTCCAAGTGAGTTTAGTGGTACAGACACTTTTAGAGAGGAAAATATTGGTTTGATTGAACAAATGG
TGACATTGTTGAGTTCAACGACTTCTGGATCTGATAGTTCCGAAACAGCTGAGATGAAGCCCTATTTGCATGAGGCATCT
CGGTCGTTGCTGTCGTTGCTAAAAGACGGGAATATTGATGATATTATCTCCTGCAAAGGTGTTCTTGTTTCTCCTGGGAA
TTTTGATATGGATGATTTGGACTCTGAAAACATTGAGGACGATCTCTATCAAAGAGGACTTGAAGACAAGTTCTGGTGGG
AATGTCCAGAAACATTACCTGAGCGTCTGCCCCAGTCATCTCTCCCTGCGAAAAGGAAACTATCAACTTTGGAGAGCTCT
AGCAGGCGTGCTAAAGGCGAAAACTCTTCTGTTGACATACCGACCCAAAATTCAGTTCACCGGGCGCTGGGTTCTTTATC
CCTTCCTCCTGCTCCCACACGTAGAGATACCTTTAGGCAGCGCAAGCCGAATACCAGCAGGCCTCCCTCTATGCATGTAG
ATGATTATGTTGCTAGGGAAAGGAGTGTTGATACAGCTGGTAATTCTAATGCAATAACCATTTCTCGAGCAGGATCTAGC
AGTGGTAGACCTCCATCTATTCATGTTGATGAGTTTATGGCCAGACAGAGAGAACGAGGCCAAAATCCATCCACCATTGT
GGTTGGAGAGGCTGTTGTGCAAGTGAAAAATCCTACTCCTGCTAGAGATTCTGAAAAAGTTGCAGGTAAACCTAAACAAT
TCAAAGCCGATCCTGATGATGATCTACAAGGAATAGATATAGTGTTTGATGGTGAGGAGTGTGAAGGACCTGATGACAAG
TTGCCATTTCTTCAGCCCGATGAGAACCTTATGCAGCCTTCTCCTGTCATGGTTGAACAAAACTCTCCTCACTCCATTGT
TGAAGAAACCGAGAGTGATGCAAATGGAAGTAGTCAATTCTCTCACATGGGCACACCAGTGGCATCTAATGTTGACGAAA
ACGTTCAGAGCGAATTTTCATCAAGGATTTCAGTTTCACGCCCTGATATGTCGTTGATTCGGGAACCAAGCATTTCTTCA
GACAGAAAATTTGTTGAGCAAGCAGACGAATCAAAGAAAATGGCCCCTCTAAAGAGTGCCGGCATATCTGAATCTGTGTT
TGTACCTGCTTACAACATGCCAGGATCTTCAGGACAAAATTTGATTGATCCTAGAGTGGGTCCTCAGGGGTTCTATTCAA
AGAGTAGTCAGCAACACACGGGCCATATTCATAGTGGATTCAGTGGTCGGGGGGTTTATGAACAGAAAGTGATGCCAAAC
CAGCCTCCTTTACCCTTAGTGCCACCTCAATCAGTCTCACCTGTGATACCACATTCCTCTGATTCTCTTTCTAATCAATC
CTCCCCTTTTATTAGTCATGGAACACAATCTTCAGGAGGACCCATCCGGCTTACGCCACCCCTCCCTTCAGCAATGCCCC
AGTACTCATCTAACCCATATGCCTCGTTACCACCAAGGACATCTACAACTCAATCTTTTGGATACAGCCAGGCAGGCGTA
GGTACCACTGAACAACAACAGAGTGGGCCAGTCATTGATCATCAGTCTGGCAATTTATCTGTTTCAGGTACCGGAATGAT
CTCTTACCCTCCCCACACTTTAATGTCAGCCCATAATTTTAGCAGGCCATCATCTCTCCCTGTGCCATTCTATGCAAATC
CTTCGCATCAAGGAGGTGATAAGCCGCAAACTATGTTGTCGGTTCCCTCCATCCCTCAATCACTAAATCCACAGTCCATC
CCTCAGCTGCAATCGATGCAGCTTTCACAGTTACAACGCCCTATGCAGCCTCCTCAGCATGTTAGACCACCCATACAGAT
ATCTCAACCATCAGAGCAAGGAGTATCAATGCAAAACCCATTTCAGATTCCAATGCATCAGATGCAGATGATGCAACAGA
CGCAAGTCCAGCCGTACTATCACACTCCTCAACAGCAAGATCTCTCTCAGGTGCAGCAACAGCCACAGCATCATGCTGTT
CAAGGTCAGCAAGGAGCTGGGACTTCTCAGCAACAAGACTCTGGAATGTCATTACATGATTACTTCAAGTCTCCAGAAGC
CATTCAGTCTCTATTAAGTGACCGTGACAAGCTGTGTCAGCTTCTGGAACAACATCCAAAGTTAATGCAGATGCTTCAGG
AAAAACTTGGGCAGCTATGA