Details for Lyrate rockcress Locus 16047903

Position : sca3 ( 5`- 8886699 .. 8885006 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047903

Protein [Map View]
MMSNYIDTLCMVSLLSCLFITSCFAGPVPNQENGSQKLIPTQISSRDRSKRLSSIVLYYLKMESFNTLMKSVYTERYESR
PFRVGRYNWTLVVYPKGNKNDNGTGYISLYVVLDISTLTSPHEEVHVDLRFYVFNKKEKKYFTIQDTDVWRFSAIKTMWG
FSKVLPLTTFNNLKNGYLYDIDHCEFGGVDVIIPAFYEKSELFSVTKSFPNERFTWFIQGFSTLPTDYLSEEFIIGRKSW
IRTCCPIVGSTSKCLTTKPYDKVYVRAKLRVPNQFPSQSNTVLERPLDNWFSPQTIGWGYADFMPLSDLRNSSKGFVVND
MLVVQVAMEEISSTKYLPN*

DNA
ATGATGAGTAACTACATAGACACCTTATGCATGGTTTCTCTCCTCTCTTGTCTCTTCATTACCTCTTGTTTTGCAGGACC
GGTCCCAAACCAGGAGAATGGCTCTCAGAAACTTATCCCCACTCAAATATCATCACGTGATAGGTCTAAGAGATTGTCCT
CCATCGTCTTATACTATCTCAAGATGGAGTCTTTCAATACACTCATGAAGTCTGTTTACACCGAGAGATATGAATCTCGT
CCTTTTAGGGTCGGTAGATACAATTGGACGCTTGTCGTATATCCTAAGGGGAACAAGAATGATAACGGTACAGGGTACAT
TTCGCTTTATGTCGTCTTAGACATCTCAACTCTAACCTCTCCACATGAAGAGGTTCATGTAGATCTCAGATTTTACGTCT
TCAACAAGAAAGAGAAGAAGTACTTTACGATCCAAGATACTGATGTATGGCGATTCAGTGCAATCAAAACCATGTGGGGG
TTTTCTAAGGTTCTTCCTCTGACTACGTTTAACAACCTGAAAAATGGCTACCTTTATGATATCGACCATTGCGAGTTTGG
CGGCGTTGACGTCATCATTCCAGCATTCTATGAGAAGTCGGAACTTTTCTCTGTCACCAAGAGTTTTCCAAACGAAAGAT
TCACCTGGTTTATTCAGGGATTCTCGACACTGCCTACTGATTACCTATCAGAGGAGTTCATCATCGGAAGAAAAAGCTGG
ATAAGGACTTGTTGCCCTATAGTGGGTAGTACCAGTAAGTGTTTAACAACAAAACCTTATGACAAGGTTTACGTACGAGC
CAAGCTTCGTGTTCCTAACCAATTCCCATCCCAATCCAACACTGTTTTGGAAAGGCCACTTGATAACTGGTTCAGTCCCC
AAACAATCGGGTGGGGTTACGCTGACTTCATGCCTCTTTCTGATCTGAGAAATTCATCAAAGGGTTTCGTTGTGAATGAT
ATGTTGGTTGTTCAAGTCGCGATGGAGGAAATTTCTTCAACAAAGTACCTTCCCAATTAG