Details for Lyrate rockcress Locus 16047771

Position : sca3 ( 5`- 22200805 .. 22200017 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047771

Protein [Map View]
MVFLSWGRPSSEQQQQVINRTGAFNYDNKYRGVSSRSIAKLKEDSEVEKDGFLINHARVLVGSGRESFEKGKKALQNWKH
FGMDWAFVDPATPVETGKKFCICVKEVLPWVILPLQVVYVDESRKSRKGPAHFGYGSGTLQGHLLAGEERFSIELDGNGE
VWYEITSFSKPAHFLSFLGYPYVKLRQKHFARHSSEAVLKHLKAS*

DNA
ATGGTGTTCTTGAGTTGGGGTCGTCCATCTTCTGAGCAACAGCAACAAGTAATCAACAGAACAGGAGCCTTCAATTATGA
CAACAAGTACAGAGGAGTTTCGTCTAGGTCTATAGCTAAACTTAAGGAAGATTCAGAAGTTGAAAAAGATGGATTCTTGA
TCAATCATGCTAGGGTTTTAGTCGGTTCAGGTAGAGAGAGTTTCGAGAAGGGCAAAAAAGCTCTACAGAATTGGAAGCAT
TTTGGTATGGATTGGGCATTTGTTGATCCTGCAACTCCTGTTGAAACCGGTAAGAAGTTTTGCATTTGTGTGAAAGAAGT
TCTTCCATGGGTGATACTTCCTCTACAAGTGGTTTATGTTGACGAAAGCCGGAAATCAAGAAAAGGCCCTGCGCATTTCG
GTTACGGAAGCGGTACTCTTCAGGGTCATTTACTCGCTGGAGAAGAACGGTTTTCGATAGAGCTTGATGGAAATGGTGAA
GTATGGTATGAGATAACATCTTTCTCAAAGCCAGCTCATTTCTTGTCGTTCCTCGGATATCCTTATGTGAAGCTAAGGCA
GAAGCACTTTGCTCGCCATTCTTCTGAAGCAGTGCTAAAACATCTCAAGGCTTCGTGA