Details for Lyrate rockcress Locus 16047699

Position : sca3 ( 5`- 4187885 .. 4189078 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047699

Protein [Map View]
MEAAAEAVSAAREQSLILKGKRTKRQRPQSPIPFSIIPPLSSHEPDAEEESTSLISKEKSLNDEINNNNNKNDNNTLIND
VTSSSSASSSSNKNATLKATADEEDQDMANCLILLAQGHSLPHHQPQPHPQQQTRQLMISYQESGNNNNAYRSSSRRFLE
TPSSNGTTTNGGGGKAGYYVYQCKTCDRTFPSFQALGGHRASHKKPKAATGLHSNHDHKKSIYDDAVSLHLNNVITTTPN
NNSNHRSLVAYGKASNNKVHECGICGAEFTSGQALGGHMRRHRGAVVAAAAASTATVAVAATQATANTALSLSPMSFDQM
SDGPVQAPVKRARSAVVSLDLDLNLPAPEDENRVNGLSFASKQEHEQEHEQTQQKKQREEQKSLVLSSPPTLVDCHY*

DNA
ATGGAAGCAGCTGCGGAGGCTGTATCAGCCGCTAGGGAGCAATCATTGATCCTTAAAGGGAAACGGACTAAGCGGCAACG
TCCGCAGTCCCCAATCCCTTTCTCTATCATCCCTCCTTTGTCTTCGCATGAACCGGATGCTGAAGAAGAGTCCACTAGTC
TTATTTCCAAGGAGAAGAGTCTCAATGATGAGATCAACAACAATAACAACAAGAATGATAACAATACTTTGATCAATGAT
GTTACATCTTCATCTTCTGCCTCTTCATCTTCCAACAAAAATGCCACATTAAAGGCCACGGCTGACGAGGAAGATCAAGA
TATGGCTAATTGTTTGATCCTTCTCGCCCAAGGCCACTCTCTTCCCCACCACCAACCGCAACCGCACCCGCAACAACAAA
CAAGACAGCTTATGATAAGTTACCAGGAATCCGGTAATAACAACAACGCGTATAGATCTAGCAGCAGGAGGTTTCTAGAG
ACACCTTCATCTAATGGGACCACAACGAATGGTGGTGGAGGCAAAGCTGGTTACTATGTTTACCAGTGCAAAACATGTGA
CCGGACTTTTCCGTCTTTCCAAGCTCTTGGCGGCCATAGAGCCAGCCACAAGAAGCCTAAAGCCGCCACGGGTCTTCACT
CCAACCATGACCACAAGAAATCTATCTACGATGACGCCGTTTCTCTCCATCTCAACAACGTTATCACCACAACTCCTAAC
AACAATAGTAACCATAGATCGCTTGTGGCATACGGTAAAGCTAGTAATAATAAGGTCCATGAATGTGGGATATGTGGAGC
CGAATTCACATCCGGGCAAGCATTAGGTGGTCACATGAGACGCCATAGAGGTGCAGTGGTGGCCGCAGCAGCCGCCTCTA
CCGCCACAGTAGCGGTTGCAGCCACTCAGGCTACTGCAAACACGGCTTTGTCATTGTCGCCTATGTCGTTTGATCAGATG
TCGGATGGTCCGGTTCAGGCTCCGGTTAAGAGAGCAAGGAGCGCGGTTGTGTCGTTAGATTTAGATCTGAATCTACCTGC
CCCGGAAGATGAGAATCGGGTCAACGGATTAAGCTTTGCTTCAAAGCAAGAACACGAACAAGAACATGAACAAACACAAC
AGAAGAAACAGAGAGAAGAACAAAAGTCTCTTGTCTTGTCATCCCCTCCTACATTGGTGGATTGCCATTACTGA