Details for Lyrate rockcress Locus 16047693

Position : sca3 ( 5`- 9981249 .. 9986948 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047693

Protein [Map View]
MAAAGNGLSRRRHRAGSFRDSPEEEGPVELPEAARLRDRGGSNKKDRDRERDRDRERERERDRERDRLNSRSKRRRGERL
MMVHGNLDDGGDDSSEESVNDDEEYDDGGAVGPPSSLKMLPPTSNNISAASFSSSLSNHHNGGSGNLHHHHNHHNNHQRK
NFPPTKVFRSSPSPAPVSPLVSTWKAADEMIGVSVPRKARSACTKRPHESWSSSTTGGGVFASGEQIHRQISSTSPANRV
SPASILASPSPPAPTSPSSSSISVRKKLSSGTKQKTLPPKSSSCKLSSSVAVQDEIEIEIAEVLYGMMRMPLATSKQESA
GNDLTEAAKPTVEVKSRVSSPISNPHTLPQSSITLATNSSSSNVSAIAPKRKKPRHVKYEDDNSSRITTIKSEAEAPSKS
QVPFGDQLKSSGSGEGNSSVLDSIIPQTRESNASLDSRSAEKKENKLSKDETILPKVESSSGFRSDGDGTKSSSPEKAKF
EIDLMAPPPVRSSSERGGEMMECVAAEAKPKVTEVETEAKPLLKEDRGDAAFHDPQEKKRPRTVVEAEHHKYERNCELKL
DLDQSDHVGLVNKLHVQKQPPQQQLSVPDKTTQGSHLPLHMSMPGWPGGLPTMGYMAPTQGVVPTDASSLSAAAMQPPPH
LLFNQPRPKRCATHCYIARNIQSHQQFTKMNPFWPAAAGSAPLYGTKACNLSLTPPTELQGSVLGRSSNPVQDKNSQSTS
KSSDTAQRNQLLLQQALPPGAANNILHGPTFIFPLGQQPHTAATIAAASVRPPNSGITSSGPTATSNSMNGSVSATPAGA
PTMSFSYPAMPGNETQYLAILQNNGYPFPVPAHVGAPPAYRGAPGQPMPFFNGSFYSSQMIQPPHHQPQKQQQQQQTGQM
LQSHAPNNQNGSVSTGSSAAQKHLQNQQLRPPINHGNSQGFPTHKVQSQPLSFQQRQQPRDNATQHSETVGEDSPSTADS
RGSRSNVAYGQNYGMQMQPTNLGLMSSPAPGGGVVGSSSSHGEKKPQQQVSKAGAESFQSQGYAMTFATFNGANTATALN
MSSVAQNQAMFHSMPEAARQGYQMMAVAQAAQQKMNYSASQEDGKSGSIGAATANTPEEQRKSGGGTTGKASGGNGGQSI
AFSNKHDLADASVSAVTSGSIVDSSSRLLNLGSALPQSSGSMPPSHHHQQLLQQQQQQQQQHMQRSQSQQPYTTMYLQKQ
QRYATSVAASAARTKGPVASNGSGFPDHNITTSPAATTKFANANTGFPQNLVQSSSNQVQSPQWKNNSPRTTNSTQAQSP
SILSPSSSVAAASSLRNVSHKQQSRPQQSQISFAANSKPMASGSPMQQVQGGTNHQAPSPPMLVGSPSTSSVSKNASGSP
RTTASASSAANKAGQASSTTHSSSQPSKNLQSASVASSAGGRNNGPSVLGNPTTSSGSKSQQQHQLPKHGMQPQAQLFFS
NPYMQAQHQHQQQQITISPSGGYYIQRHQQQSGSAPAAVATCPPVTGAVSATSDPAKALAAAAAANNMKGGSGMGKTQQH
QLGPPGFTNVHAVPSAVQVKPVDQKQQAGE*

DNA
ATGGCGGCTGCCGGAAATGGTCTTTCACGGCGGAGACATAGAGCCGGAAGTTTCAGAGATTCACCAGAGGAGGAAGGTCC
GGTGGAGTTACCGGAGGCGGCGAGGTTGAGAGATCGAGGAGGGAGTAATAAGAAGGATCGAGATCGGGAACGTGATAGAG
ACAGAGAGAGGGAAAGAGAAAGAGATAGAGAGAGAGATCGGTTAAATAGCCGGAGTAAACGGAGAAGAGGAGAACGGTTA
ATGATGGTTCACGGTAATTTAGACGACGGTGGTGACGATAGCTCGGAAGAGAGTGTTAACGACGATGAAGAATATGACGA
CGGAGGAGCTGTAGGACCACCGTCTTCGTTGAAGATGCTTCCTCCGACGAGTAATAATATCTCCGCCGCATCGTTTTCAT
CGTCTCTTTCAAATCATCACAACGGTGGTAGCGGTAATCTTCATCACCATCACAACCATCATAATAACCATCAGAGGAAG
AATTTCCCGCCGACGAAAGTTTTCAGATCGTCTCCTTCTCCGGCGCCGGTTTCACCTCTTGTGTCGACATGGAAAGCCGC
TGACGAAATGATCGGTGTTTCGGTTCCTAGAAAAGCTCGGTCAGCTTGTACGAAGAGACCTCATGAATCATGGTCGTCAA
GTACTACCGGAGGTGGTGTTTTTGCTTCCGGTGAACAAATCCACCGCCAAATATCATCAACGTCTCCAGCTAATAGAGTT
AGTCCGGCTTCAATTTTAGCATCTCCGTCTCCTCCAGCTCCTACATCTCCTTCTTCATCAAGCATTTCAGTCCGGAAAAA
ATTGTCGTCGGGGACAAAACAGAAGACGCTACCGCCGAAATCATCATCGTGTAAGTTATCATCGTCGGTGGCTGTACAAG
ACGAGATCGAGATTGAGATTGCAGAAGTGTTGTACGGTATGATGAGGATGCCTTTGGCTACCTCAAAACAAGAATCCGCC
GGTAACGATTTGACGGAGGCAGCGAAACCAACAGTAGAAGTCAAATCTAGAGTATCTTCACCGATCTCAAATCCTCATAC
TCTTCCTCAATCCTCCATCACACTGGCTACAAATTCTAGCTCTTCCAATGTTTCTGCCATTGCTCCTAAGAGAAAGAAGC
CAAGACATGTCAAATACGAAGATGATAACAGTTCACGCATCACTACGATCAAATCCGAAGCCGAAGCTCCTTCGAAAAGT
CAAGTTCCGTTTGGTGATCAGCTTAAGAGCTCAGGATCCGGCGAAGGAAACAGCTCTGTATTGGATTCGATCATTCCACA
AACGAGAGAAAGTAACGCTTCGTTAGATTCGAGATCAGCTGAGAAAAAAGAGAACAAACTGTCAAAAGATGAAACAATAT
TGCCGAAAGTGGAATCTTCTTCAGGATTTAGATCCGATGGTGATGGAACTAAATCGAGTTCGCCGGAAAAAGCGAAGTTT
GAGATAGATCTGATGGCGCCACCGCCGGTGAGATCATCGTCGGAGAGAGGCGGAGAGATGATGGAATGTGTGGCAGCAGA
AGCTAAACCTAAAGTCACGGAAGTGGAAACGGAAGCAAAGCCTCTGCTGAAGGAAGATAGAGGTGATGCGGCGTTTCATG
ATCCTCAAGAGAAGAAGAGACCTAGAACGGTGGTAGAAGCTGAACACCATAAGTATGAGAGGAATTGTGAACTTAAACTC
GACTTGGATCAATCTGATCATGTTGGTTTAGTAAACAAGCTTCATGTTCAGAAGCAGCCACCGCAGCAACAACTATCTGT
TCCTGATAAAACAACTCAAGGTAGCCATTTGCCTCTGCATATGTCTATGCCTGGCTGGCCTGGGGGCCTTCCTACAATGG
GATATATGGCACCTACGCAAGGAGTTGTGCCTACGGATGCCAGTTCCTTATCTGCTGCAGCAATGCAGCCTCCACCGCAT
TTACTTTTTAATCAACCGAGGCCTAAGCGATGTGCTACACACTGCTACATTGCTCGGAATATTCAATCTCATCAGCAATT
CACAAAGATGAATCCTTTCTGGCCTGCAGCAGCAGGCTCAGCTCCATTGTATGGGACCAAGGCCTGCAATCTTAGTCTCA
CGCCTCCCACAGAACTTCAGGGGAGTGTTTTGGGAAGAAGTTCCAACCCTGTTCAAGATAAGAATTCTCAATCTACGTCC
AAAAGCTCAGATACAGCTCAGAGAAATCAATTATTGCTCCAACAAGCTTTGCCTCCAGGAGCCGCTAATAACATCTTGCA
TGGTCCTACATTCATATTCCCCTTGGGCCAACAGCCTCATACGGCCGCTACAATAGCTGCTGCATCTGTCAGACCTCCTA
ATAGTGGCATCACATCTTCTGGACCAACAGCTACTTCTAACTCCATGAATGGTTCTGTATCCGCTACTCCAGCTGGTGCC
CCAACAATGAGCTTCAGTTACCCGGCCATGCCGGGAAATGAAACGCAGTACCTGGCCATTTTACAGAATAACGGCTATCC
ATTTCCAGTTCCAGCACATGTTGGTGCACCACCTGCTTATAGAGGAGCTCCTGGGCAGCCGATGCCATTTTTTAATGGTT
CATTCTATTCCTCCCAAATGATCCAGCCTCCACATCATCAGCCACAGAAGCAGCAACAGCAGCAGCAAACTGGTCAAATG
CTCCAGAGCCATGCTCCTAACAACCAGAATGGGAGTGTTTCCACTGGTTCCTCAGCAGCACAAAAGCATCTGCAGAACCA
ACAGTTGAGGCCACCGATCAATCATGGGAACTCCCAAGGATTTCCAACTCATAAAGTCCAGTCTCAGCCTTTGAGTTTTC
AGCAGAGGCAGCAACCCAGAGACAATGCAACTCAACATAGTGAGACTGTAGGGGAAGATAGCCCATCAACTGCTGATAGC
CGGGGTTCTCGTTCCAATGTTGCCTATGGCCAGAACTATGGTATGCAAATGCAACCAACCAACTTGGGTTTGATGAGTTC
ACCAGCCCCAGGTGGTGGAGTGGTTGGATCTTCGAGCAGTCATGGTGAAAAGAAACCACAGCAGCAGGTTTCAAAGGCTG
GGGCAGAATCCTTCCAGTCACAGGGTTATGCTATGACTTTTGCAACGTTCAATGGGGCTAACACTGCTACTGCCCTAAAC
ATGTCATCAGTTGCTCAGAATCAAGCTATGTTTCACAGCATGCCCGAAGCAGCGAGGCAAGGTTATCAGATGATGGCAGT
TGCTCAAGCAGCTCAACAAAAAATGAACTACAGTGCTTCTCAAGAAGATGGAAAATCCGGGTCTATTGGTGCTGCTACTG
CTAATACCCCAGAGGAACAAAGGAAGTCAGGAGGAGGAACAACAGGGAAAGCGAGTGGTGGGAATGGTGGGCAGTCTATT
GCTTTCTCTAACAAACACGATTTAGCTGATGCATCTGTTTCTGCTGTCACGAGTGGTAGCATCGTTGATAGCTCATCCCG
TTTGCTCAACCTTGGTTCTGCTCTGCCACAGAGTTCGGGTTCTATGCCCCCGTCTCATCATCATCAGCAACTACTACAGC
AACAGCAGCAGCAGCAGCAGCAGCATATGCAACGGAGTCAATCACAGCAACCTTATACCACCATGTATCTCCAGAAGCAG
CAACGGTATGCAACTTCAGTGGCTGCTTCTGCTGCTAGAACCAAAGGGCCCGTGGCGAGTAACGGGAGTGGTTTCCCTGA
TCACAATATCACCACATCACCTGCGGCAACCACCAAGTTTGCAAATGCTAATACAGGGTTCCCTCAAAACCTTGTCCAGT
CGAGCAGCAATCAGGTTCAGTCTCCTCAGTGGAAAAACAATTCACCCAGGACAACAAATAGTACCCAAGCTCAGTCTCCT
TCGATACTGTCGCCATCATCATCAGTTGCTGCTGCATCGTCACTAAGAAATGTCTCGCATAAACAGCAAAGCCGTCCCCA
GCAATCGCAGATATCTTTTGCAGCAAACTCGAAACCAATGGCTTCTGGTTCACCAATGCAGCAGGTGCAAGGAGGAACCA
ACCACCAGGCTCCGTCTCCACCAATGTTAGTTGGGTCGCCTTCGACGTCTTCCGTCTCCAAAAACGCCAGCGGAAGCCCA
AGAACAACTGCTTCCGCTTCCTCGGCAGCTAACAAAGCTGGACAAGCTTCCTCTACTACTCACTCATCATCTCAGCCGTC
CAAGAACTTACAGTCTGCATCTGTGGCGTCATCTGCTGGTGGAAGGAACAATGGTCCTTCTGTTCTTGGAAACCCGACCA
CGAGCTCTGGATCCAAGTCGCAGCAACAGCATCAGTTGCCAAAGCATGGGATGCAGCCGCAAGCACAGCTTTTCTTCTCT
AATCCTTACATGCAAGCTCAACATCAACATCAACAGCAACAGATCACTATATCTCCTTCTGGTGGGTATTACATCCAAAG
ACATCAGCAACAGTCAGGTTCAGCACCTGCTGCTGTAGCCACATGTCCTCCAGTCACGGGAGCCGTCAGCGCCACTTCAG
ATCCAGCGAAAGCCCTAGCGGCAGCAGCAGCAGCAAATAACATGAAAGGAGGAAGTGGTATGGGTAAAACTCAACAACAT
CAGCTTGGGCCTCCAGGGTTCACGAATGTTCACGCGGTTCCCTCTGCGGTTCAGGTTAAACCTGTGGATCAGAAGCAACA
AGCGGGTGAGTGA