Details for Lyrate rockcress Locus 16047687

Position : sca3 ( 5`- 1806794 .. 1804571 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047687

Protein [Map View]
MVFDGRFYANKPELAARRIEAIGYQVGHQLSERYTMERPRFSDHLEAIKFICKDFWSEVFKKQIDNLKTNHRGTFVLQDN
KFRWLSRVSIDPSSENETEDPSTPGESKAAQAVSMYLYFPCGIIRGVLSNLGIPCAVSADISSLPTCSFVIRVKA*

DNA
ATGGTTTTTGATGGTCGATTCTACGCTAACAAGCCGGAACTCGCCGCTCGGAGGATCGAGGCCATTGGTTATCAGGTCGG
CCACCAACTCTCCGAGAGGTACACTATGGAAAGACCAAGGTTCAGTGACCATCTAGAGGCAATCAAGTTTATCTGCAAAG
ACTTCTGGTCTGAGGTCTTCAAGAAGCAGATAGATAACTTAAAGACAAATCACCGGGGTACTTTTGTATTGCAAGACAAC
AAGTTCCGGTGGTTGTCTCGTGTCTCAATTGACCCTTCATCTGAGAACGAAACCGAAGATCCATCTACTCCAGGGGAAAG
CAAAGCAGCACAAGCGGTGAGCATGTACCTATATTTCCCATGTGGAATCATAAGAGGTGTCCTCTCCAACTTGGGGATAC
CGTGTGCTGTCTCTGCAGATATATCAAGCCTTCCCACATGCTCTTTCGTGATTCGGGTAAAGGCTTGA