Details for Lyrate rockcress Locus 16047681

Position : sca3 ( 5`- 8723212 .. 8724723 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047681

Protein [Map View]
MGSSSSPSPNDAVLESARPFLRGELEKIDPKLPSLIAVLKSVGAGECWHKHGSFLDHLIDIYKILKLWKAPESVCLCGLF
HSAYSNSYVNLAIFDPSTGREVVRDHVGEAAESLIHLFCVVPRQTLIHDDLLFKYSDCELVEHLDCSEVSLRNAKEKGVF
DGDEEWRKKINGLVPENGAVVKHIKTGEEIVVSRRVVGVFLFMTMADFSDQLFGFQDELFCNHDGRLEFRGNNVTALWPG
NGKPGLWLNSNSRMGAIYSLIVREEEILMEERRRAFGSGFEVRKERDEDIELVVPPVFSFCTKVLDAKEQIEAREMYWEV
VSSDTSKEGYLERAEERLLGCIEKNPFVGEPHVLLSQVYLGKKRFNEAEREAEKGLLLLLQWGSPWDKRMSWEGWIAWVR
VLLMKSQDQSWPDVSWGILNLGLVR*

DNA
ATGGGTTCATCATCATCTCCATCCCCAAACGACGCCGTACTTGAATCAGCCCGGCCCTTTCTCCGAGGAGAGCTCGAGAA
GATCGACCCCAAACTTCCGTCGTTGATCGCCGTCCTCAAAAGCGTCGGTGCCGGCGAGTGTTGGCACAAACACGGAAGCT
TCCTAGATCACTTGATCGATATCTACAAGATCCTCAAGCTATGGAAAGCTCCTGAATCTGTCTGCCTCTGTGGTTTATTT
CACTCTGCTTACTCCAATTCTTATGTCAATTTAGCTATTTTCGATCCTTCCACTGGCCGTGAAGTCGTTCGTGATCATGT
CGGTGAAGCTGCTGAGTCGTTGATCCATCTCTTTTGCGTTGTACCGAGACAAACTCTGATTCACGACGATCTTTTGTTTA
AGTACTCTGATTGTGAGCTCGTTGAGCATCTTGATTGTTCTGAGGTTTCGTTGAGGAACGCCAAGGAGAAAGGGGTCTTT
GATGGAGATGAAGAGTGGAGGAAGAAGATTAATGGTTTGGTTCCTGAGAATGGTGCTGTTGTGAAGCATATCAAGACAGG
TGAAGAAATCGTTGTTTCGAGGAGAGTTGTTGGTGTTTTCTTGTTCATGACAATGGCGGATTTTAGTGATCAGCTTTTTG
GGTTTCAAGATGAGCTGTTCTGTAATCATGATGGGAGACTTGAGTTTAGAGGGAACAACGTGACTGCGTTGTGGCCTGGG
AATGGGAAACCTGGACTGTGGTTGAATTCGAATTCGAGGATGGGAGCGATTTATAGTTTGATTGTGAGAGAAGAGGAGAT
TTTGATGGAGGAGAGGAGAAGGGCTTTTGGTTCTGGGTTTGAAGTGAGAAAGGAGAGAGATGAGGACATAGAGCTCGTTG
TGCCTCCAGTTTTCAGCTTCTGCACCAAGGTATTGGATGCCAAAGAGCAGATAGAAGCAAGGGAGATGTACTGGGAAGTT
GTGAGCAGTGACACAAGCAAAGAAGGGTACTTGGAGAGAGCAGAGGAGAGATTGTTGGGGTGTATTGAGAAGAACCCATT
TGTGGGAGAGCCACATGTGTTGTTGAGTCAAGTGTACTTGGGAAAGAAGAGATTCAATGAAGCAGAGAGAGAGGCAGAGA
AAGGGCTTCTTCTGCTCTTGCAATGGGGAAGTCCTTGGGACAAGAGGATGTCATGGGAAGGTTGGATTGCTTGGGTTAGG
GTGCTTCTCATGAAGTCACAGGATCAATCTTGGCCTGATGTTTCTTGGGGTATCTTGAACTTGGGTCTTGTGCGCTAA