Details for Lyrate rockcress Locus 16047677

Position : sca3 ( 5`- 6426171 .. 6426395 -3` )
Annotation : [B2G] ATCOX17 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047677

Protein [Map View]
MSDQTAQNGLIPSPTSEPSKAAASAETKPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHKMCLRAEGFNV*

DNA
ATGAGTGATCAAACAGCACAAAACGGCTTGATTCCTTCACCCACTTCAGAGCCAAGCAAGGCTGCTGCCTCGGCAGAGAC
GAAACCAAAGAAGAGGATATGTTGTGCTTGCCCTGATACGAAGAAGCTGAGAGATGAGTGCATTGTCGAGCATGGTGAAT
CGGCTTGCACTAAATGGATCGAGGCTCATAAAATGTGTCTCCGAGCAGAAGGTTTCAATGTCTGA