Details for Lyrate rockcress Locus 16047652

Position : sca3 ( 5`- 3245003 .. 3246568 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047652

Protein [Map View]
MKKKAIVIDDGYRRFMRTRPMSEKIDVPIICLDEDDNDDLMIDKDYNVFLDHLRRGDNDSLTPRLEVDNGESDIRRLKIF
SCDSKRPKLGNENPVKNRVHQQGKRRTVGFKAERVNIRENIQRDNRVAERRKRRIAELEAAKTSRDVPSLKTQQEDTQQR
DNKVRKLSESKAETLRRDDVPLVGTQEDSQRDHTVSQGRKRNNDDALRRDVPLVETEEDIQQTSEVVRMERVNRVTEVND
VVETSSRSKEVFVGRKNKNEDGSEAVVDKNYMRYLTWLVDSLRDSSTTEPMENLQKDQSDLDTLKESTMVPEMDPLVEVK
VEPDHDWSDYIIAMGDSPFLDGEECTPFVVSKKVVDLDEGSKEDESSSSWFRKELMDVLQKPYDEGELKLLHRYASIHRK
MTRCRELRKGRESDYETDELGQSYLESFPDFEKEYKLVVGVDKARALKLLRGFFLYLKYVSHDGVFKPWERNQRWQT*

DNA
ATGAAGAAGAAAGCCATTGTGATTGACGATGGATATAGAAGGTTTATGCGTACTCGTCCAATGTCTGAAAAAATCGATGT
TCCAATTATCTGTCTTGACGAAGATGATAATGATGATCTTATGATTGATAAGGACTACAACGTGTTCTTGGATCATCTTC
GAAGAGGTGATAATGACAGTTTAACTCCTCGCCTTGAGGTTGACAATGGAGAATCTGACATTCGTAGATTAAAGATCTTT
TCTTGTGATTCAAAGAGACCAAAGCTTGGGAATGAGAATCCAGTGAAGAACAGAGTTCATCAACAGGGCAAGAGGAGAAC
TGTTGGGTTTAAGGCTGAAAGAGTTAATATCCGAGAAAACATTCAACGAGACAACAGAGTTGCTGAACGAAGAAAGCGGA
GAATTGCTGAGTTAGAAGCTGCAAAGACTTCAAGAGATGTTCCTTCACTCAAAACCCAACAAGAAGACACTCAACAACGA
GACAACAAAGTTAGGAAACTTTCAGAGTCAAAGGCTGAGACTTTAAGAAGAGATGATGTTCCATTGGTTGGAACTCAAGA
AGACAGTCAACGAGACCACACAGTTTCTCAAGGGAGAAAGAGGAATAATGACGATGCTTTAAGAAGAGATGTTCCATTGG
TTGAAACTGAAGAAGACATTCAACAGACTTCAGAGGTTGTTCGCATGGAGCGAGTAAATAGAGTTACAGAGGTTAATGAT
GTAGTTGAGACTTCTTCAAGGAGCAAAGAAGTTTTTGTAGGGCGAAAGAATAAGAATGAGGATGGGAGTGAAGCGGTTGT
GGATAAGAATTACATGAGGTACCTCACATGGCTTGTAGATTCTCTTAGAGATTCTTCGACAACTGAGCCAATGGAAAATC
TTCAGAAAGATCAGTCTGATTTGGATACTCTAAAAGAATCGACAATGGTCCCTGAAATGGATCCACTAGTAGAAGTGAAG
GTTGAACCAGATCATGATTGGTCTGATTATATAATTGCCATGGGTGATTCTCCGTTTTTGGATGGAGAGGAGTGTACACC
GTTTGTGGTGTCCAAGAAAGTTGTTGATCTAGATGAAGGAAGTAAAGAGGATGAAAGTAGTAGTAGTTGGTTTAGAAAGG
AGCTAATGGATGTTCTGCAAAAACCATATGACGAAGGAGAGTTGAAGCTGCTCCATCGTTACGCATCAATCCATAGAAAA
ATGACTCGATGCAGAGAACTACGAAAGGGGAGAGAATCTGATTATGAGACTGACGAACTTGGACAATCTTATCTAGAAAG
TTTCCCTGATTTCGAAAAAGAATACAAGCTTGTGGTTGGTGTTGATAAGGCAAGAGCATTGAAGTTGCTGCGTGGGTTTT
TCTTGTACTTGAAATATGTTTCTCATGATGGTGTTTTCAAGCCTTGGGAGAGGAATCAAAGGTGGCAAACTTAA