Details for Lyrate rockcress Locus 16047648

Position : sca3 ( 5`- 10015344 .. 10008734 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047648

Protein [Map View]
MGKKDEKVEAVLRLVKKQSPLTFKQEKFCNRECVERFLKVKGDNVKKAAKQLISCLSWRQSFDIERLGAEEFSTELSDGV
AYISGHDGESRPVIIFRFKHDYQKLRTQKQFTRLVAFTIETAISSMSRNAEQSFVLLFDASFFRSSSAFVNLLLATLKII
ADNYPCRLDKAFIIDPPSYFSYLWKGVRPFVELSTVTMIVSSLDYDERLDISHVSSNPRSASLRLDASSIKSTATIGSAS
SRFAFTVSQNSLKPWYLSFTDTSPYNPAVSSSTAAQVSPLSARSLYFASPAARGFKEAKPAACRKSLFPSTPLPEKTKTV
SYRKTPRPSFFQSPAMLFRRENNVGGGGEKSRESFVPYLKFYRRPYDETAYRSKLRGTRGFVSVVSSHRRSRHVSLSQRF
*

DNA
ATGGGAAAGAAAGACGAGAAAGTCGAAGCTGTTCTTCGTTTGGTCAAGAAACAATCTCCACTCACTTTTAAACAAGAGAA
GTTCTGTAACAGAGAGTGTGTTGAGAGATTCTTGAAGGTTAAAGGAGATAATGTGAAAAAAGCTGCGAAACAACTCATTT
CATGTCTTTCTTGGAGACAAAGCTTCGATATTGAGCGATTAGGAGCAGAGGAGTTCTCGACGGAGCTTAGCGACGGTGTA
GCTTACATCTCCGGTCACGACGGAGAATCAAGACCTGTTATTATTTTCCGTTTTAAGCATGATTATCAGAAGCTGCGTAC
CCAAAAACAATTTACGCGTTTGGTGGCGTTCACGATTGAGACTGCGATTTCGAGCATGTCCAGAAACGCGGAACAGAGCT
TTGTTCTTCTCTTCGATGCAAGCTTTTTCAGATCATCCTCTGCATTTGTGAATTTGCTTTTGGCGACCCTAAAAATCATC
GCAGATAATTACCCATGCCGACTTGACAAAGCCTTTATCATCGACCCTCCCTCTTATTTCTCTTACCTTTGGAAGGGTGT
TCGTCCTTTTGTGGAGCTCTCAACGGTCACGATGATAGTGTCGTCTCTAGACTACGACGAAAGGCTAGATATCAGCCACG
TGTCGTCAAATCCTCGATCAGCATCTTTAAGATTAGACGCATCGTCGATTAAATCAACGGCCACGATTGGTTCAGCTTCT
TCAAGATTCGCTTTCACCGTCTCTCAAAACTCCTTGAAGCCGTGGTATCTTTCCTTCACCGACACGTCCCCTTATAACCC
CGCCGTCTCCTCATCCACCGCCGCTCAAGTTTCTCCTCTCAGCGCACGGTCGCTATATTTCGCGTCTCCGGCGGCGCGTG
GTTTCAAAGAAGCGAAACCAGCTGCATGCAGAAAGAGTTTGTTTCCATCTACGCCGTTGCCGGAGAAGACAAAGACGGTT
TCGTACCGGAAAACTCCACGTCCTTCGTTCTTTCAGTCGCCGGCGATGCTCTTTCGCAGGGAGAATAATGTCGGTGGAGG
AGGCGAGAAGTCCCGTGAATCGTTTGTACCGTATCTGAAGTTTTACCGGAGACCGTACGATGAGACTGCGTATAGGTCTA
AGCTGCGTGGTACACGTGGATTTGTGTCGGTCGTGTCTTCGCACAGAAGATCTCGCCACGTGTCTTTATCTCAACGGTTC
TGA