Details for Lyrate rockcress Locus 16047632

Position : sca3 ( 5`- 600068 .. 600727 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047632

Protein [Map View]
MSALRLRNANTPAPELDEFSDQTPSDSRVLKRQMSISQRAMSNTLTSAANLSNLLPTGTLLAFQLLTPVFTSNGVCDHAT
RFLTAVLLFLLAASCFVSSFTDSVKAEDGTIYFGFVTFKGMWVVDYPDPSGLGLPDLAKYRMRVVDWIHATLSVLVFGAV
ALRDKYITDCFCPSPEAETKHVLDIVPVGVGVMCSLLFMVFPARRHGIGYLVTGSVDRR*

DNA
ATGTCTGCCCTACGGCTAAGAAACGCAAACACTCCTGCTCCGGAGCTCGACGAGTTTTCCGATCAGACACCGTCAGATTC
ACGGGTGCTCAAGAGACAGATGTCGATATCTCAGCGAGCCATGTCAAACACCCTGACGTCAGCAGCCAATCTCTCAAACC
TCCTACCAACGGGAACACTCCTCGCGTTTCAACTCCTAACGCCGGTTTTCACTTCAAACGGCGTTTGCGACCACGCAACG
CGTTTCCTAACCGCCGTTCTCCTCTTCCTCTTAGCCGCGTCTTGCTTCGTCAGCTCCTTCACCGATAGCGTTAAAGCCGA
GGATGGAACAATCTACTTCGGTTTCGTCACGTTCAAAGGCATGTGGGTCGTTGACTATCCTGACCCGTCCGGATTGGGTT
TACCCGATTTAGCCAAATATCGGATGCGGGTCGTTGATTGGATCCACGCTACGTTGTCGGTTTTAGTGTTTGGAGCGGTT
GCGTTGAGAGATAAGTATATAACTGATTGCTTTTGTCCGTCGCCGGAGGCAGAGACGAAACATGTCTTGGACATTGTTCC
GGTGGGTGTTGGGGTTATGTGTAGTCTTTTGTTTATGGTTTTTCCGGCGAGGCGTCACGGGATTGGATATCTTGTTACCG
GTAGCGTTGATCGCCGGTGA