Details for Lyrate rockcress Locus 16047602

Position : sca3 ( 5`- 8019842 .. 8019192 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047602

Protein [Map View]
MDPSEYFAGGNPSDQQNQKRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPNRDQPPPYIPREPVVIYAVSPKVVHATA
SEFMNVVQRLTGISSGVFLESGGGGDVSPAARLASTENASPRGGKEPAARNETVEITMEEAAEFGGYAPGILSPSPAMLA
TASAGIFSPMYHQGGMFSPAIPPGLFSPAGLMYSPGFASLVASPTFADVFRNIWDP*

DNA
ATGGATCCGTCGGAGTATTTTGCCGGCGGCAATCCTTCTGACCAACAGAACCAGAAGCGGCAGCTTCAGATCTGTGGTCC
TCGTCCTTCACCTCTTAGTGTCCACAAAGACTCTCACAAAATCAAGAAACCTCCAAAACACCCTGCGCCGCCGCCAAATC
GTGACCAACCTCCGCCGTATATTCCTAGAGAGCCGGTGGTTATCTACGCCGTATCCCCCAAGGTTGTACACGCCACCGCG
TCGGAGTTCATGAACGTCGTCCAGCGACTCACAGGGATCTCCTCTGGAGTTTTCCTCGAATCTGGCGGCGGTGGAGATGT
TTCACCGGCGGCGAGGCTAGCGTCGACGGAGAATGCTAGTCCAAGAGGAGGAAAAGAACCGGCTGCGAGAAATGAGACGG
TGGAAATCACTATGGAAGAAGCAGCTGAATTTGGTGGTTATGCTCCGGGAATACTCTCGCCATCTCCGGCGATGTTAGCA
ACAGCTTCTGCCGGGATATTCTCTCCGATGTATCATCAAGGTGGGATGTTTTCGCCGGCTATACCACCGGGATTATTCTC
GCCGGCGGGATTAATGTATAGTCCTGGTTTTGCTAGTTTGGTCGCTTCTCCAACATTTGCTGATGTCTTTAGAAATATCT
GGGATCCTTAG