Details for Lyrate rockcress Locus 16047589

Position : sca3 ( 5`- 5042997 .. 5034605 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047589

Protein [Map View]
MNGSAQSACHVGYGTSYWAHSFVFRPGQSPGSSRLLQLGAAGSASRLRSSSSKKPPEPLRRAVADCLSSSPPPVNSHHGA
IPSMAPSEALRNLRDYLSASATTDLAYNMLLEHTIAERDRSPAVVTRCVALLKRYLLRYKPGEETLLQVDKFCVNLIAEC
DASLKQKSLPVLSASAGASPLPVSSFASAALVKSLHYVRSLVALHIPRRSFQPAAFAGATLASRQLLPSLSSLLSKSFNS
QLSPANAAESPQKKDAANLSVSNLSNIQEINAMEDTEYISSDLLNWRWVGELQLSSASSESERPINLQDMNNCNLLEVGA
AGLLVGDMEAKMKGQHWKYFGTTEMPYLEQLLQPASVTMITNSASARSHLRAITASKRTRAGPQQIWDDSTVNTFRPRAR
PLFQYRHYSEQQPLRLNPAEVGEVIAAVCSEASSTPSNQMTVSPQLTSKTGKPSMDVAVSVLIKLVIDMYVLDARIAAPL
TLSMLEEMLCSTKAGCRIRVFDLILNLGVHAQLLEPMISDNATTIEEEYAQETYIDNENRLLLQGTRTKDLPKMSSTSSA
IENFESWILKILFEILLLLVQVEEKEECVWASALSCLLYFICDRGKIRRNQLNGLDIRVIKALLGTSKRNSWSEVVHSKL
ICIMTNMFYRSPEPEGSTKAISSASNFLIDQVDLIGGVEYIFFEYSLATTREERRNLYSVLFDYVLHQINEACSAAGLSE
YTDDEIQPLAVRLALADAPEAFYISVKLGVEGIGEILRRSIAAALSGFSNSERLNQLLANITEKFDMIIGSFTHLDKEFL
HLKQITKSSKYMESIRDLRNDISMSVNLAWATLHSLLHSERTTYRQNGYIWLGDLLIAEISEESSGSIWLSIKDLQQKIA
HCGTSDSLVTSDVPVSIHLLCGLLKSRNSVIRWGFLFILERLLMRSKFLLDENETQRSTGGVASQDHKDKRLEKANAVID
IMSSALSLMAQINETDRINILKMCDILFSQLCLKVLSTDEDAVPNSADRKFDSSHRNSYKESMDEADTRPRYNNVSVSTC
ETASMAAMLLRGQAIVPMQLVARVPAALFYWPLIQLAGAATDNIALGVAVGSKGRGNIPGATSDIRATLLLLLIGKCTAD
TIAFQEVGGEEFFRELLDDTDSRRMMTEEPEKYQNMLQKLVFKAQQSNNEKLLENPYLQMCGILQLSNEL*

DNA
ATGAACGGATCGGCACAGTCAGCATGTCACGTGGGTTATGGGACATCTTATTGGGCCCATTCTTTTGTTTTTCGCCCCGG
TCAAAGCCCCGGAAGCTCCCGGTTGCTGCAGCTGGGCGCTGCCGGCTCTGCCTCGCGCCTTAGATCTTCTTCCTCCAAGA
AGCCCCCTGAGCCACTACGTCGAGCCGTGGCGGACTGCCTCTCATCGTCTCCTCCTCCGGTTAATTCGCACCATGGCGCG
ATCCCTTCCATGGCTCCGTCGGAAGCTCTCAGGAATCTCCGGGATTATCTATCAGCCTCCGCCACGACTGACCTGGCCTA
CAACATGCTGTTAGAGCATACTATAGCAGAGAGAGATCGCAGCCCAGCTGTGGTTACGAGGTGTGTGGCACTACTGAAAC
GGTATCTCTTAAGATATAAGCCTGGCGAGGAGACACTACTGCAGGTCGATAAATTTTGCGTGAACCTGATTGCTGAGTGC
GATGCTAGCTTGAAGCAAAAATCATTGCCTGTTTTATCAGCATCAGCGGGTGCTTCTCCTTTACCAGTGTCCAGTTTTGC
TTCTGCAGCTCTGGTGAAGTCATTGCATTATGTGCGTTCCCTTGTGGCTTTACATATCCCAAGGCGATCCTTCCAACCTG
CAGCATTTGCAGGAGCTACTCTTGCGTCAAGACAGTTATTGCCATCTCTATCTTCTTTGTTGAGCAAATCATTCAATTCC
CAATTAAGTCCTGCAAATGCCGCAGAATCTCCACAGAAAAAGGATGCTGCAAATCTGTCTGTTTCAAACTTGTCAAATAT
ACAAGAAATTAATGCTATGGAAGACACTGAATACATATCGTCAGACTTGCTGAATTGGCGTTGGGTTGGGGAGCTCCAGT
TATCATCAGCTTCTTCTGAAAGCGAACGCCCTATTAATCTCCAAGACATGAACAATTGTAATCTTCTGGAAGTTGGTGCT
GCCGGCCTGCTTGTAGGAGATATGGAAGCTAAAATGAAGGGTCAGCACTGGAAATATTTTGGTACCACAGAGATGCCTTA
TTTAGAGCAACTGCTGCAGCCAGCTTCAGTCACGATGATAACAAACTCTGCCTCAGCTCGCTCCCACTTGAGAGCAATAA
CAGCTTCCAAACGCACCAGAGCTGGCCCTCAGCAGATCTGGGATGATTCCACTGTAAACACATTTCGTCCACGTGCCAGA
CCGCTTTTTCAGTACCGTCATTACAGTGAACAACAACCACTGCGCTTAAACCCTGCCGAGGTAGGTGAGGTGATCGCTGC
TGTTTGTTCTGAGGCATCATCCACCCCTTCAAATCAAATGACTGTATCACCCCAATTAACGAGCAAGACTGGAAAGCCGT
CGATGGATGTGGCTGTGAGCGTCCTAATTAAGCTTGTTATCGACATGTATGTATTGGACGCTAGAATTGCTGCTCCTCTT
ACTCTATCCATGCTTGAGGAAATGCTATGCTCCACAAAAGCAGGTTGTAGGATTCGTGTATTTGATTTAATTCTTAATTT
AGGAGTTCATGCGCAATTGTTAGAGCCAATGATAAGTGATAATGCGACAACCATTGAAGAAGAATATGCCCAAGAAACAT
ATATCGACAATGAAAATAGGCTTCTGCTACAAGGGACAAGAACGAAAGACTTGCCGAAGATGTCAAGCACTTCTTCGGCT
ATTGAGAACTTTGAGTCTTGGATATTGAAAATCTTATTTGAAATACTTCTTCTCCTAGTTCAGGTTGAGGAAAAGGAAGA
ATGTGTTTGGGCCTCTGCCCTCAGCTGCTTGCTCTATTTTATCTGTGATAGAGGCAAAATACGGAGAAACCAGCTAAATG
GTCTTGACATAAGGGTTATTAAAGCTCTTCTGGGAACTAGCAAAAGGAATTCTTGGTCAGAAGTTGTTCACTCCAAGCTT
ATTTGTATCATGACGAATATGTTTTATCGATCTCCAGAACCAGAGGGCTCTACCAAAGCAATTTCAAGTGCCTCAAATTT
TCTTATCGACCAGGTCGATCTGATTGGTGGTGTTGAATACATTTTCTTTGAGTACTCTTTGGCAACCACTAGAGAGGAAA
GAAGAAATCTCTACTCGGTTTTATTTGACTATGTCCTGCATCAAATTAATGAGGCATGCTCAGCTGCTGGTCTTTCTGAG
TACACTGATGATGAGATTCAACCTTTGGCTGTTCGGCTTGCTCTTGCGGATGCACCTGAAGCTTTCTACATTTCTGTTAA
GCTTGGTGTTGAAGGCATAGGGGAAATCCTGCGAAGATCAATTGCTGCAGCATTGTCTGGGTTCAGCAACAGCGAACGAC
TTAACCAGCTTTTGGCAAATATAACAGAAAAGTTTGACATGATAATAGGTTCGTTTACTCACTTGGACAAAGAGTTCCTG
CATCTCAAACAGATAACCAAATCTTCCAAGTACATGGAAAGCATTAGAGATTTAAGAAACGATATAAGCATGTCAGTGAA
TCTAGCTTGGGCTACTTTGCACTCCCTTCTTCATTCAGAAAGGACCACATACCGTCAAAATGGATATATCTGGTTGGGGG
ATCTTCTGATTGCAGAAATTAGTGAAGAGAGCAGTGGAAGTATATGGCTGAGCATAAAAGATCTTCAACAAAAGATTGCC
CATTGTGGTACCTCAGACTCTCTGGTTACTTCTGATGTACCTGTTTCCATACATCTTCTATGTGGACTCTTGAAGTCAAG
AAACAGTGTTATCAGATGGGGTTTCCTATTCATTCTGGAGAGGCTTCTTATGCGCTCCAAGTTCTTACTAGATGAGAATG
AGACCCAACGATCAACTGGTGGAGTTGCTTCTCAGGATCATAAAGACAAACGACTAGAGAAAGCAAATGCTGTCATAGAC
ATAATGAGCAGTGCTTTGTCTTTGATGGCACAAATAAATGAAACTGACCGGATTAATATCTTAAAGATGTGTGACATTCT
TTTCTCGCAATTGTGCTTGAAAGTTTTGTCTACTGACGAGGATGCAGTCCCCAATTCTGCAGATAGGAAATTTGATTCTT
CTCATCGTAACAGCTATAAAGAAAGTATGGATGAAGCTGACACCAGGCCTCGGTACAACAATGTCTCTGTTTCAACGTGC
GAGACAGCATCAATGGCAGCGATGCTTCTTCGAGGACAGGCAATTGTTCCTATGCAGCTGGTTGCGCGTGTGCCAGCGGC
TTTGTTTTATTGGCCATTGATTCAACTAGCAGGTGCAGCAACTGACAACATCGCACTTGGTGTCGCCGTTGGAAGCAAAG
GTAGAGGAAATATTCCAGGTGCAACCTCTGATATTCGAGCCACCCTGCTATTACTTCTGATTGGTAAATGCACCGCTGAT
ACAATTGCTTTTCAAGAAGTTGGCGGAGAGGAGTTCTTTAGGGAACTCCTGGATGATACTGATTCAAGGAGGATGATGAC
GGAGGAACCAGAGAAATACCAAAACATGCTTCAGAAGCTTGTCTTTAAGGCTCAGCAGAGCAATAATGAGAAACTGCTGG
AGAATCCATATCTGCAGATGTGTGGTATACTTCAGCTATCAAACGAGCTATGA