Details for Lyrate rockcress Locus 16047580

Position : sca3 ( 5`- 4740134 .. 4738140 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047580

Protein [Map View]
MESPIKCCDCGCDCCSSSGSWIRSVKKRRHDELQTEKRFSIPELDDLDMFSNPRVQIENECELLRETVSNQQQTIQDLYH
ELEEERIASSTAVDEALNLIGKLQKEKTDMLMELTQLQRCVKDRLTYENAEIEALEAVVYQRDQTIQALTFETQAYKHRM
MSFGLTEAEADGERNLLSRNPSMIDINSEYDFPIPDYPPLKCNINENQDPLEADIYVADDENYPPADSPHGREHLKTLDR
RLSQMETYPSFTQLNRGRDVSEKSMVGQSPRRQRHFRRISPTGSSSHLGASKELRPDAFVDSPRSRSYMKMEDVSYTENN
NAKDDSSEIGDDMSDRVYTIDSVHHSSVSHSGGVTEQKLEDGTSDGNVVFPREHTDLGDPNITKLYMRLQALEADRESMK
HALLSMRTEKAQMVLLKEIAQHLSKEVVPQRRLPLRKASIARPLTFTPVFKWITSFVSWKRKARRSKYMFGMSGNNIGLQ
MLLEKVPRSRKWRCLRSTQV*

DNA
ATGGAGTCTCCGATCAAATGTTGCGACTGTGGATGCGATTGTTGTTCTTCCTCAGGTTCATGGATTCGATCTGTGAAGAA
GAGAAGACACGATGAATTACAGACCGAGAAACGCTTCTCTATACCGGAGCTGGATGACCTAGACATGTTCTCTAATCCTA
GAGTCCAAATCGAGAACGAATGTGAATTACTACGCGAGACTGTTAGCAATCAACAGCAAACGATTCAGGATTTGTATCAT
GAGCTCGAGGAAGAGCGTATTGCTTCATCAACAGCTGTAGATGAAGCACTGAATCTGATTGGGAAGTTGCAGAAGGAAAA
GACTGATATGCTGATGGAACTGACACAGCTTCAGCGTTGTGTTAAGGACAGATTGACTTATGAAAACGCAGAGATTGAGG
CATTGGAAGCTGTGGTTTATCAAAGGGATCAGACGATTCAGGCTCTTACATTTGAAACTCAGGCTTATAAGCACAGAATG
ATGAGCTTTGGGCTAACCGAGGCAGAAGCTGATGGTGAGAGGAACTTGCTTAGTCGTAACCCGAGCATGATCGACATTAA
TTCCGAATACGACTTCCCTATACCTGATTACCCTCCTCTAAAGTGCAATATTAATGAGAACCAAGATCCTCTTGAGGCTG
ATATCTATGTTGCAGATGATGAAAACTACCCACCAGCTGATTCCCCTCATGGACGAGAACATTTGAAGACTTTGGATCGA
AGACTCAGCCAGATGGAGACATATCCTAGCTTTACTCAGTTGAATAGAGGGAGAGATGTTTCAGAGAAGTCAATGGTTGG
TCAGAGTCCTAGGCGTCAAAGACATTTTAGGAGGATTTCCCCTACTGGTTCAAGTTCACACTTGGGAGCATCTAAAGAAC
TAAGACCTGATGCTTTTGTTGATTCCCCGAGGTCCAGAAGCTACATGAAAATGGAAGATGTCTCATATACAGAGAATAAT
AATGCTAAAGACGACTCATCGGAAATAGGAGATGACATGAGTGATAGAGTTTATACCATTGATTCTGTCCATCACAGCAG
TGTGTCTCATAGTGGCGGTGTAACTGAGCAGAAGCTTGAGGATGGCACTTCTGATGGCAATGTGGTTTTCCCGAGAGAAC
ACACGGATCTTGGTGATCCTAATATAACGAAACTCTACATGAGGCTTCAAGCACTGGAGGCTGACAGGGAATCAATGAAA
CATGCGCTTCTCTCTATGAGGACTGAAAAGGCTCAAATGGTACTGTTGAAAGAAATTGCTCAACATTTGTCAAAGGAAGT
TGTCCCTCAACGGAGATTGCCTCTACGTAAAGCGTCTATTGCTAGGCCATTGACTTTCACGCCGGTCTTTAAGTGGATCA
CATCTTTTGTTTCCTGGAAAAGAAAGGCTCGTCGAAGCAAATACATGTTTGGAATGTCAGGAAACAACATCGGCTTGCAA
ATGCTTCTAGAAAAAGTCCCTCGGTCACGAAAATGGCGATGTCTTAGGAGCACGCAAGTGTGA