Details for Lyrate rockcress Locus 16047571

Position : sca3 ( 5`- 1286704 .. 1285452 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477645 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047571

Protein [Map View]
MRPPMRGGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDEGPPSEVVEVATFLHACEGDAVTKLSNEK
IPHFNAAIYLENKTQIGKVDEIFGPINESLFSIKMMEGIVATSYSPGDKFFIDPYKLLPLSRFLPQPKGQSTGGRGGAGR
GRGDGRGRGRGGSFRGRGAPRGGRFPPRGGSRGSFRGRGRF*

DNA
ATGAGACCACCGATGAGAGGCGGCGGGGGTTTCCGTGGAAGGGGAGGACGAGACGGTGGTGGTGGCGGTAGATTCGGTGG
AGGTGGCGGTAGATTCGGTGGAGGAGGAGGACGCTTTGGTGGTGGAGGCGGTCGCTTTGGTGGTTTCAGAGACGAAGGTC
CTCCTAGCGAAGTCGTGGAGGTCGCAACTTTCCTTCATGCTTGCGAGGGAGATGCTGTGACTAAACTCTCAAATGAGAAG
ATTCCTCATTTTAATGCTGCCATCTACCTAGAGAACAAGACTCAGATTGGGAAAGTAGATGAAATCTTTGGCCCTATTAA
TGAATCTTTGTTTTCTATCAAAATGATGGAAGGTATTGTAGCCACCTCCTATTCTCCAGGAGATAAGTTCTTCATCGACC
CTTACAAGCTTTTGCCTCTCTCTCGATTCCTTCCTCAGCCAAAGGGTCAGTCAACGGGTGGACGTGGAGGTGCAGGTCGT
GGAAGAGGTGATGGTAGAGGTCGTGGAAGAGGTGGATCTTTTAGAGGTAGAGGCGCTCCAAGAGGTGGTAGATTTCCACC
ACGCGGTGGCTCTCGTGGAAGCTTTAGAGGCCGAGGAAGATTTTAG