Details for Lyrate rockcress Locus 16047570

Position : sca3 ( 5`- 7601001 .. 7599429 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16047570

Protein [Map View]
MDAVTASLVRSPVLPPRTSDNGSGSMFLTASGPGFTRSGSSRLQLRLRVCPKSLQNASARSSRSLQSLTTTAKTRRSFVV
RASSASNDASSGSSPKPIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSDGQNKDASSVPGTDIVLYRRI
AEVKENERRRTLEEILYALVVQKFMEANVSLVPSVSPSSDPSGRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMG
DLNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGLDESKTSVEQTEEKTTYQAVSSHPEVGSFAGGVS
AKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLV
LEAVTFGSFLWDVESHVDARYHFVLN*

DNA
ATGGATGCCGTGACGGCGAGTTTGGTTCGATCTCCCGTCTTACCACCTAGAACTTCCGACAACGGTTCTGGATCTATGTT
CCTTACCGCCAGTGGCCCTGGATTCACGCGTTCTGGTTCTTCAAGACTTCAACTTCGTTTAAGGGTATGTCCCAAATCTC
TTCAAAACGCGTCTGCTAGATCCTCAAGATCGTTGCAAAGCTTAACAACGACTGCTAAAACTCGGAGAAGTTTTGTGGTT
AGAGCTTCTTCAGCGTCTAATGATGCTTCTTCTGGTTCGTCCCCCAAACCGATCGCGCCACTTCAGCTTCAATCGCCTGC
TGGTCAGTTTCTGTCTCAGATTTTGGTGAGCCATCCTCATCTTGTGCCTGCAGCTGTTGAACAGCAGCTTGAGCAGCTTC
AAACTGATCGGGACTCTGATGGACAGAACAAGGATGCATCGTCTGTACCTGGAACCGACATCGTTCTCTACAGGAGGATT
GCGGAGGTGAAGGAAAACGAGAGAAGAAGGACATTGGAAGAGATTTTGTATGCATTGGTGGTTCAAAAGTTCATGGAAGC
TAATGTATCACTTGTACCATCAGTAAGCCCATCTTCAGATCCGTCTGGTCGGGTTGATACTTGGCCGACCAAAGTGGAGA
AACTTGAGCGGCTTCACTCTCCCGAGATGTACGAGATGATTCACAACCATCTAGCCCTGATTCTCGGAAGCAGAATGGGT
GATCTGAACTCTGTTGCTCAGATAAGCAAGCTCAGAGTTGGGCAAGTTTACGCTGCTTCTGTTATGTATGGGTATTTCTT
GAAGAGGGTGGACCAAAGGTTTCAGCTTGAGAAGACAATGAAAATTCTTCCGGGTGGGTTGGATGAGAGTAAAACAAGCG
TTGAACAAACAGAGGAGAAGACGACATATCAGGCGGTATCCTCTCACCCAGAGGTTGGTTCATTTGCAGGCGGAGTTAGT
GCTAAGGGCTTTGGCAGCGAGATTAAACCGTCCCGGTTAAGGTCATACGTGATGTCATTTGATGCGGAGACGCTTCAGAG
ATACGCCACTATAAGATCAAGAGAAGCTGTTGGAATCATCGAGAAGCACACAGAGGCATTGTTTGGTAAGCCCGAGATTG
TAATAACACCAGAAGGAACGGTTGATTCATCGAAGGACGAACAGATAAAGATCAGCTTCGGTGGAATGAAGAGGCTTGTC
TTGGAGGCTGTGACTTTCGGGTCGTTCCTTTGGGATGTTGAGAGCCATGTAGATGCTAGGTACCACTTTGTATTGAACTA
A