Details for Lyrate rockcress Locus 16047546

Position : sca3 ( 5`- 7902350 .. 7903587 -3` )
Annotation : [B2G] calcium-binding ef hand family protein
External links : CoGe
PGDD synteny : 16047546

Protein [Map View]
MGNTSSMLTQYDIEEVQSHCHDLFEQQEILSLYQRFCQLDRNAKGFISSDEFLSVPEFAMNPLSQRLLKMVDGLNFKDFV
AFLSAFSAKASLRQKVQLIFKVYDSDCNGKVSFKDIMEVLRDLSGSFMSDEQREQVLSQVLKESGYTSDSFLTLEDFIKI
FGSSRPEMDVEIPVD*

DNA
ATGGGAAACACTTCATCGATGCTGACTCAATACGACATCGAAGAAGTTCAGAGCCATTGTCATGATCTATTTGAGCAGCA
GGAAATTCTATCTCTATATCAAAGGTTTTGCCAGTTAGATCGAAACGCAAAGGGATTTATATCTTCTGATGAGTTTCTCT
CTGTACCTGAGTTTGCCATGAATCCACTATCTCAGAGGCTGCTTAAGATGGTTGATGGTTTGAACTTTAAGGATTTTGTG
GCTTTCTTGTCTGCATTTAGTGCCAAGGCTAGTCTAAGACAGAAAGTTCAGTTGATCTTTAAAGTCTATGATTCGGACTG
CAACGGTAAGGTCTCCTTTAAAGATATCATGGAAGTGTTGCGTGACTTATCCGGATCATTCATGTCTGATGAGCAAAGAG
AGCAAGTACTGAGCCAGGTTTTGAAGGAATCGGGCTACACAAGTGACTCTTTCTTAACACTAGAGGATTTCATTAAGATC
TTTGGGAGTAGTAGACCGGAGATGGATGTTGAAATTCCTGTGGATTAG