Details for Lyrate rockcress Locus 16047523

Position : sca3 ( 5`- 1226194 .. 1223160 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477625 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047523

Protein [Map View]
MRKLFCGMPLLLLVLLLASIDGSTQLQSSQSQTLLRLQQLLFYPKVLSSWNNFTDFCNSEPSPSLTVVCYEDSVTQLHII
GDNGTHMLPKSFSINSFVTTLVKLPDVKVLTFASLGLWGWLPQKINRLSSLEILNVSSNFFFGPIPHELSSLANLQTLIL
DENMFSGQLPDWIGSLPSLAVLSLRKNVFNGSLPSSLINLSGLRVLALANNRFNGALPDLSHLTNLQVLDLEGNSFGPLF
PRLSNKLVTLVLSKNKFRSAVSAEEVSSLYQLQHLDLSYNTFVGPFPTSLMSLPAITYLNISHNKLTGRLSANLSCNSQL
MFVDMSSNLLTGSLPTCLKPSSGTSRDVVYASNCLATTNEDQRPVSFCSNEALAVGILPQRRNKVSKVGIALGVTASILG
VILLACALFVVLRRLNAKRTVTISSPRLIRENASMGYTSKLLSDARYISQTMKLGALGLPAYRTFSLEELEYATNNFESS
AFMGEGSQGQIYRGRLKDGSFVAIRCLKMKKSCSTQNLMHHIELIAKLRHRHLVSVLGHCFECYLDDSTVSRMFFVFEYV
PNGELRSWISDGHMGRLLTWEQRISVAIGVAKGIQFLHTGIVPGVYDNNLKITDILLDNNLAAKVSSYNLPLLVEGLGKV
GQVGSRSGPKGTPIIKSEDKIDIYDFGVILLELIVGRPLRAKSQVDVLKEQLQASISADDGARRSMVDPTVHRDCSDQSL
KTMMEICVRCLLKDPLERPSIEDVMWNLQFASQVQEGWLQNSNPSSIRGSPSPDASSLPPPSRLHVTTLESPRDSGCEEH
ER*

DNA
ATGAGGAAACTCTTCTGTGGCATGCCACTACTGCTTCTGGTTCTGCTTTTAGCTTCCATTGATGGCTCTACACAGCTTCA
ATCATCTCAATCTCAAACTCTCTTGAGGCTGCAACAACTTCTCTTCTATCCCAAAGTGTTAAGCAGCTGGAACAACTTTA
CTGATTTCTGCAATTCTGAGCCAAGCCCTTCGCTAACCGTGGTGTGTTATGAAGATAGTGTAACGCAGCTTCACATTATA
GGAGACAATGGAACTCATATGTTACCAAAGAGTTTCTCAATTAACTCGTTTGTAACTACTCTTGTTAAGCTCCCTGATGT
TAAAGTTCTCACCTTTGCGTCTCTCGGGTTATGGGGTTGGTTACCTCAGAAAATCAACCGTTTATCCTCTTTGGAGATTC
TCAATGTGAGTTCTAATTTCTTCTTTGGACCAATCCCTCATGAACTCTCATCGCTCGCTAACCTTCAGACGCTTATACTC
GATGAGAATATGTTTTCTGGTCAGTTACCGGATTGGATTGGTTCTTTGCCGAGTTTAGCTGTGTTGAGCTTGAGAAAGAA
CGTGTTTAATGGGTCATTGCCTTCTTCACTGATTAACTTGTCAGGTCTTAGAGTTCTTGCTTTAGCTAATAACCGCTTTA
ATGGAGCTTTACCTGATTTAAGCCATTTGACAAACCTTCAAGTGCTTGATCTTGAAGGAAACTCTTTTGGGCCGTTGTTT
CCTCGGTTAAGTAACAAGTTGGTTACTCTTGTACTCAGCAAGAACAAGTTTAGATCTGCAGTTTCAGCTGAAGAAGTGAG
TTCTTTGTATCAGCTTCAGCATTTGGATCTTTCCTACAATACATTCGTCGGTCCATTTCCTACTTCCTTGATGTCTCTTC
CCGCGATAACTTACTTGAACATTTCACACAACAAACTCACCGGGCGGCTTTCAGCAAATCTTTCTTGCAACTCACAGCTG
ATGTTTGTCGATATGTCCTCAAATCTTCTTACGGGAAGTTTGCCTACTTGCCTTAAACCGAGTTCCGGCACTAGCAGAGA
TGTTGTCTATGCAAGCAACTGTTTGGCTACTACGAATGAAGATCAACGTCCAGTTTCATTTTGTAGCAATGAAGCTCTTG
CTGTTGGAATCCTACCACAGAGGAGGAACAAAGTTTCCAAAGTGGGTATTGCTTTAGGCGTAACCGCAAGCATTCTCGGG
GTAATTCTCCTCGCCTGTGCCTTATTTGTGGTTCTTAGGAGATTAAATGCAAAGAGAACAGTGACGATATCTTCCCCAAG
ATTGATAAGAGAGAATGCTTCAATGGGCTACACATCAAAATTACTATCAGATGCAAGGTATATATCTCAAACAATGAAGC
TGGGAGCGCTTGGTCTTCCAGCTTACAGAACATTCTCACTGGAAGAGCTCGAGTATGCGACAAATAACTTTGAATCCTCT
GCTTTCATGGGTGAAGGTTCTCAAGGACAGATTTATAGGGGGAGATTGAAAGATGGATCCTTTGTGGCAATTAGATGTTT
GAAGATGAAGAAAAGTTGCAGCACACAAAACTTGATGCATCACATTGAGCTCATTGCTAAACTGAGGCACCGTCACTTGG
TTAGTGTGCTCGGGCACTGCTTCGAGTGCTACTTGGATGATTCAACAGTCAGCAGAATGTTCTTTGTCTTTGAGTATGTC
CCAAATGGAGAACTCAGGAGCTGGATTTCTGATGGTCACATGGGAAGATTGCTTACTTGGGAACAACGCATAAGCGTAGC
GATAGGTGTAGCTAAAGGGATCCAGTTCTTGCATACTGGTATTGTGCCTGGTGTTTATGATAACAACCTTAAAATAACAG
ACATTTTGCTTGACAATAACCTCGCGGCGAAAGTCAGTAGCTATAATCTTCCATTACTTGTGGAAGGTCTTGGAAAGGTG
GGACAAGTAGGATCTCGAAGCGGACCTAAAGGCACTCCAATCATAAAAAGCGAAGATAAAATCGATATATATGATTTTGG
AGTGATCTTGCTTGAACTTATAGTGGGAAGACCATTGAGAGCAAAGAGTCAAGTTGATGTTCTAAAAGAGCAGTTACAAG
CAAGCATTTCAGCGGATGATGGAGCACGTAGGAGCATGGTGGATCCAACGGTACATAGAGATTGTTCAGACCAATCACTG
AAGACAATGATGGAGATATGTGTAAGGTGTCTCCTTAAAGACCCTTTAGAACGTCCTTCCATTGAAGATGTCATGTGGAA
TCTTCAGTTTGCTTCTCAAGTTCAAGAAGGTTGGCTACAAAACAGCAATCCCTCGAGCATTCGCGGCTCGCCTTCTCCGG
ATGCTTCCTCTCTTCCTCCTCCCTCTCGTTTACATGTAACAACACTCGAATCTCCCCGAGATTCAGGATGTGAAGAACAT
GAGAGGTAG