Details for Lyrate rockcress Locus 16047519

Position : sca3 ( 5`- 7459723 .. 7458165 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479224 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16047519

Protein [Map View]
MAAVPRGLISRINQFLSIRSITPSSSESLPHCSFFLLRRFSSDTGSVDVGGSDIIGAPNRIIEAKQGEMSQSSRRTGIIA
VKCGMTALWDKWGARVPISILWVDDNIVSQVKTVEKEGIFALQIGCGQKKPKHLSKAVVGHFRAQGVPLKRKLREFPVTE
DALLPVGTSLGVRHFVPGQYVDVTGITRGKGFQGCMKRHGFSGMPGSHGASLSHRSGGSTGQRDAPGKVFKGKKMAGRMG
ADQRTVKNVWVYKIDPARNLMWVRGQVPGAEGNFVFIKDAWCKKPDISKLPFPTYLAPEDEDPSELEPLVADLGEVDPFM
LAE*

DNA
ATGGCGGCCGTACCGAGAGGCCTCATTTCTCGCATCAATCAGTTTTTATCAATCCGGTCTATAACTCCTTCATCCTCTGA
ATCTCTACCTCATTGTAGCTTCTTTCTGCTCCGACGATTCAGCTCCGATACTGGGTCGGTCGACGTTGGTGGATCTGATA
TTATTGGGGCTCCGAATAGAATCATCGAGGCGAAACAAGGTGAGATGTCTCAGAGCTCTAGAAGGACTGGGATCATCGCC
GTTAAGTGCGGGATGACTGCGCTCTGGGACAAATGGGGAGCTAGGGTTCCGATTTCTATTCTTTGGGTTGATGACAACAT
TGTCTCTCAGGTTAAAACTGTTGAGAAAGAAGGCATTTTTGCGTTACAGATCGGATGTGGGCAAAAGAAACCGAAGCATT
TGTCAAAGGCTGTGGTGGGGCATTTCAGAGCACAAGGTGTGCCGTTAAAGAGGAAGTTGAGGGAATTTCCTGTGACTGAA
GACGCTCTTCTTCCTGTTGGTACTTCACTCGGAGTCCGCCATTTTGTTCCGGGACAGTATGTTGATGTCACTGGGATCAC
TCGAGGAAAAGGTTTTCAGGGATGCATGAAAAGACATGGTTTCAGTGGAATGCCGGGATCACATGGTGCTTCATTGTCCC
ATCGAAGCGGTGGTTCCACAGGGCAAAGAGATGCTCCTGGAAAGGTGTTCAAGGGAAAAAAAATGGCTGGGAGAATGGGT
GCAGATCAGAGGACAGTAAAGAACGTTTGGGTTTACAAGATCGATCCTGCGAGGAACCTCATGTGGGTGAGAGGACAAGT
TCCTGGTGCAGAAGGAAACTTTGTGTTCATAAAAGATGCATGGTGCAAGAAACCAGACATTTCAAAGCTTCCATTTCCAA
CTTACTTAGCTCCGGAAGATGAAGATCCATCAGAATTAGAACCGTTGGTCGCAGATCTTGGAGAAGTCGACCCATTTATG
TTGGCAGAGTGA